DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prp38 and prp-38

DIOPT Version :8

Sequence 1:NP_610463.2 Gene:Prp38 / 35934 FlyBaseID:FBgn0050342 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_505762.1 Gene:prp-38 / 179499 WormBaseID:WBGene00008380 Length:320 Species:Caenorhabditis elegans

Alignment Length:335 Identity:174/335 - (51%)
Similarity:218/335 - (65%) Gaps:31/335 - (9%)


  Fly     1 MANRTVKEAKNVHGTNPQYLIEKIIRSRIYDSKYWKEQCFALTAELLVDKAMELRFVGGVYGGNI 65
            |||||.|.||.|.|||||:|:|||||.|||||.||||.||||||||:|||.|:||::||:|.|||
 Worm     1 MANRTEKAAKTVKGTNPQFLVEKIIRQRIYDSMYWKEHCFALTAELVVDKGMDLRYIGGIYAGNI 65

  Fly    66 KPTQFLCLTLKMLQIQPEKDIVVEFIKNEEFKYVRALGAFYLRLTGAALDCYKYLEPLYIDNRKL 130
            |||.||||.||||||||:||||:|||:.|||||:|||||.|||||..:.:.||||||||.|.|||
 Worm    66 KPTPFLCLALKMLQIQPDKDIVLEFIQQEEFKYIRALGAMYLRLTFDSTEIYKYLEPLYNDFRKL 130

  Fly   131 RRQNRAGQFEIVYMDEYIDELLRNDRVCDIILPRIQKRSILEENNEIEPKVSVLDEDLDDELPSD 195
            |..|:.|:||.:|||::||.|||.||.|||.|||:|||..|||.:.:....|:||.||.....||
 Worm   131 RYMNKMGRFEAIYMDDFIDNLLREDRYCDIQLPRLQKRWALEEVDMLPSYKSLLDGDLVAMSDSD 195

  Fly   196 EEKADETNRPKENSTAVRRPRRVRSKSRSRSRERERRSGQGNSARSRDYYDELEDYDRQRNRVRN 260
            .|:.:.|.:.|.         |:.|:.|||||:|||..|.....             |:|.:::.
 Worm   196 SEEEEVTKKEKP---------RLTSRRRSRSRDRERDVGDRREV-------------REREKLKE 238

  Fly   261 RDTHNEDYDRRQNNG---RHDRERERQDRDSIRERERDGDRDRRD---RERERERDRGRHDQRER 319
            |....:|.....::|   |.||:..|:|||..|:|:|   |||||   |::::|..||..|..|.
 Worm   239 RRERGDDEPGPSSSGSGRRDDRDDRRRDRDRSRDRDR---RDRRDDDRRDKKKESRRGGADNDEE 300

  Fly   320 DSRGERDRRR 329
            ....|.:..|
 Worm   301 REIAEANALR 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prp38NP_610463.2 PRP38 10..172 CDD:281379 115/161 (71%)
prp-38NP_505762.1 PRP38 10..172 CDD:281379 115/161 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C269018585
eggNOG 1 0.900 E1_KOG2889
Hieranoid 1 1.000
Homologene 1 1.000 H135452
Inparanoid 1 1.050 314 1.000 Inparanoid score I1514
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005281
OrthoInspector 1 1.000 T476730
orthoMCL 1 0.900 OOG5_128828
Panther 1 1.100 LDO PTHR23142
Phylome 1 0.910 0.974 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R993
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.