DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alc and amk2

Sequence 1:NP_610460.1 Gene:alc FlyBaseID:FBgn0260972 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_588485.1 Gene:amk2 PomBaseID:SPCC1919.03c Length:298 Species:Schizosaccharomyces pombe

Alignment Length:266 Identity:84/267 (31%)
Similarity:132/267 (49%) Gaps:48/267 (18%)


  Fly   107 AHDDATSAVTRDHSSMDNNEEE----EEAAVGAEPATG-----SQLTGDEDDIRKT-------AL 155
            |.||    :.::....|:|::|    ..:..|...::|     ||.:|     :||       .:
pombe    44 AADD----LNQEGEMSDDNQQEGGNNRTSQNGTSGSSGHTKRRSQTSG-----KKTHQPYSGPCV 99

  Fly   156 PTVLRWDGGGKNVTISGTFSDWKPMAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKLKSVE 220
            ||::||.|||:.|.::|:||.||....:...:::..::.|..|..::||.|||.|.......:..
pombe   100 PTIIRWRGGGEVVYVTGSFSRWKKKIQLLKSEDYTVLLQLRPGTQRFKFLVDGIWCCSSDFPTAT 164

  Fly   221 NAEGQRNNLVSV------------RESDFEVFQALAKDSENVTNYAEKEYSQEVPQVKPWE---- 269
            :|||...|.:.|            |.|.......:.:.||:      ::||.|:|......    
pombe   165 DAEGNLYNYLEVEANEKLGASIDERLSQVHTDLPMEEKSES------EQYSTEIPAFLTSNTLQE 223

  Fly   270 -KVSGPPVLPPHLLQVILNKDTPLSCEPTLLPEPNHVMLNHLYALSIKDGVMVLSATHRYRKKYV 333
             |:..||.|||||.:.|||.:|....:.::||.||||:||||.|.:.:.||:.||||.||.:|||
pombe   224 LKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYV 288

  Fly   334 TTLLYK 339
            ||.::|
pombe   289 TTAMFK 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alcNP_610460.1 AMPK1_CBM 156..238 CDD:293169 28/94 (30%)
AMPKBI 254..341 CDD:214973 41/92 (45%)
amk2NP_588485.1 AMPK1_CBM 100..180 CDD:293169 26/80 (33%)
AMPKBI 202..294 CDD:214973 42/98 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H38160
Inparanoid 1 1.050 128 1.000 Inparanoid score I1415
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000712
OrthoInspector 1 1.000 T1124234
orthoMCL 1 0.900 OOG5_127587
Panther 1 1.100 LDO PTHR10343
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1739
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.