DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE13 and GSTF14

Sequence 1:NP_001188889.1 Gene:GstE13 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana

Alignment Length:228 Identity:59/229 (26%)
Similarity:101/229 (44%) Gaps:36/229 (16%)


  Fly    26 GLDLELKPVDFAKKEHLSEEFVK-LNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAG-NDQLYP 88
            |||.||..||:...|..::.|:. |||..::||..|.|.::: :..||..:|..:|.. ...|.|
plant    27 GLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLF-EPKAITRYLAEQYKDVGTNLLP 90

  Fly    89 RDLKRRAHIDHRMHYENG----VLFQVVKDIVARNIYGGEG------EYNPRSLTLCHNAYSDLE 143
            .|.|:||.:...|..::.    :...::|:::. |.|.|..      :.|...|:...|.|   |
plant    91 DDPKKRAIMSMWMEVDSNQFLPIASTLIKELII-NPYQGLATDDTAVQENKEKLSEVLNIY---E 151

  Fly   144 HFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKY-------PQTKQWMERMDKLLP---- 197
            ..|.:..::.|...|:||  :| .|..:|.|:..:.|:.       |....|:|:| |:.|    
plant   152 TRLGESPYLAGESFSLAD--LH-HLAPIDYLLNTDEEELKNLIYSRPNVAAWVEKM-KMRPAWLK 212

  Fly   198 ----DNEEINLKGARALQTRILSCMAENKAKSQ 226
                .|..::|...|.|..::.|...|:...:|
plant   213 TVVMKNHIVDLMKQRRLPIKLDSSCHESTVVAQ 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 19/53 (36%)
GST_C_Delta_Epsilon 92..211 CDD:198287 33/144 (23%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 19/54 (35%)
PLN02473 20..219 CDD:166114 53/201 (26%)
GST_C_Phi 94..214 CDD:198296 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.