DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE13 and eef1e1

Sequence 1:NP_001188889.1 Gene:GstE13 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_692806.3 Gene:eef1e1 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio

Alignment Length:147 Identity:33/148 (22%)
Similarity:60/148 (41%) Gaps:35/148 (24%)


  Fly    54 QIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKRRA----HIDHRMHYENGVLFQVVKD 114
            ::||..:::|........|.|.|| |.|...:|...|.::||    .::||:...:....:.||.
Zfish    28 KVPVLQNNNGPALTGLVTIACHLV-KEAKRPELLGDDAEQRAVVQQWLEHRITKLDNCSKEEVKV 91

  Fly   115 IVARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADV----SIHTTLVTLDLLI 175
            |:                       .||..:|:...::.||..::||:    .||..:|.|.:  
Zfish    92 IL-----------------------KDLNRYLEDKVYLAGNVFTLADILMYYGIHHIIVELAI-- 131

  Fly   176 PVEREKYPQTKQWMERM 192
             .|:|.|....:|.:.:
Zfish   132 -QEKECYLNVSRWFDHI 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 7/24 (29%)
GST_C_Delta_Epsilon 92..211 CDD:198287 22/110 (20%)
eef1e1XP_692806.3 GST_C_AIMP3 64..161 CDD:198338 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.