| Sequence 1: | NP_610457.1 | Gene: | GstE13 / 35928 | FlyBaseID: | FBgn0033381 | Length: | 226 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001165053.1 | Gene: | Mars1 / 216443 | MGIID: | 1345633 | Length: | 910 | Species: | Mus musculus |
| Alignment Length: | 207 | Identity: | 41/207 - (19%) |
|---|---|---|---|
| Similarity: | 70/207 - (33%) | Gaps: | 85/207 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 KKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKR-RAHIDHRM 101
Fly 102 HYEN-----------------GVLFQVVKDIVARNIYGGEGEYNPRSL--------TL-----CH 136
Fly 137 NAYSDLEHFLQQGSF--------------------VVGNEL------SVADVSIHTTLVT----L 171
Fly 172 DLLIPVEREKYP 183 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE13 | NP_610457.1 | GstA | 5..192 | CDD:440390 | 41/207 (20%) |
| Mars1 | NP_001165053.1 | GST_N_5 | 1..74 | CDD:436537 | |
| GST_C_MetRS_N | 77..179 | CDD:198340 | 26/123 (21%) | ||
| PLN02610 | 258..>848 | CDD:215329 | 1/1 (100%) | ||
| 'HIGH' region | 275..285 | ||||
| 'KMSKS' region | 595..599 | ||||
| MetRS_RNA | 855..899 | CDD:238475 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||