DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE13 and Mars

Sequence 1:NP_001188889.1 Gene:GstE13 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001165053.1 Gene:Mars MGIID:1345633 Length:910 Species:Mus musculus

Alignment Length:207 Identity:41/208 (20%)
Similarity:70/208 (34%) Gaps:85/208 (41%)


  Fly    38 KKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHAIVCFLVAKYAGNDQLYPRDLKR-RAHIDHRM 101
            :::.|:.::::.......||.          |.|:.|.:|....|.|.|.|  |:| ..||||.:
Mouse    76 EQDDLTNQWLEWEATELQPVL----------SAALHCLVVQGKKGEDILGP--LRRVLTHIDHSL 128

  Fly   102 HYEN-----------------GVLFQVVKDIVARNIYGGEGEYNPRSL--------TL-----CH 136
            ..:|                 |.|:.:::|          ..|.|..|        ||     |.
Mouse   129 SRQNCPFLAGDTESLADIVLWGALYPLLQD----------PAYLPEELGALQSWFQTLSTQEPCQ 183

  Fly   137 NAYSDLEHFLQQGSF--------------------VVGNEL------SVADVSIHTTLVT----L 171
            .|...:  ..|||..                    .|.|||      ::::..|.|.:..    |
Mouse   184 RAAETV--LKQQGVLALRLYLQKQPQPQPPPPEGRTVSNELEEEELATLSEEDIVTAVAAWEKGL 246

  Fly   172 DLLIPVEREKYP 183
            :.|.|::.:::|
Mouse   247 ESLPPLKLQQHP 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 7/40 (18%)
GST_C_Delta_Epsilon 92..211 CDD:198287 29/154 (19%)
MarsNP_001165053.1 Thioredoxin_like 1..68 CDD:294274
GstA <47..189 CDD:223698 28/135 (21%)
GST_C_MetRS_N 77..179 CDD:198340 26/124 (21%)
PRK12268 266..821 CDD:237029
MetRS_core 267..635 CDD:173907
'HIGH' region 275..285
'KMSKS' region 595..599
Anticodon_Ia_Met 644..773 CDD:153411
MetRS_RNA 855..899 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.