DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE13 and Gstt3

Sequence 1:NP_001188889.1 Gene:GstE13 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_598755.1 Gene:Gstt3 MGIID:2143526 Length:241 Species:Mus musculus

Alignment Length:229 Identity:58/230 (25%)
Similarity:101/230 (44%) Gaps:46/230 (20%)


  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70
            ||..|.|.|.||..:.||..|:..:|:.::..|.:..::.|.::||..::|...|.| .|..:|.
Mouse     5 LYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSFAQVNPLRKVPALKDGD-FVLAESV 68

  Fly    71 AIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQ-------------------VVKDIV 116
            ||:.:|..||...|..||:||:.||.:|..:.:::..|..                   |..:::
Mouse    69 AILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCTRAMWQKMMFPVFLGQPVPPEML 133

  Fly   117 ARNIYGGEGEYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVER-- 179
            |..:...:|         |.....|  .||:..:|:.|:.:||||:     :...:|:.||..  
Mouse   134 ASTLAELDG---------CLQVLED--KFLRNQAFLTGSHISVADL-----VAITELMHPVSAGC 182

  Fly   180 ---EKYPQTKQWMERM-----DKLLPDNEEINLK 205
               |..|:...|.:|:     :.|..:..|:.||
Mouse   183 KIFESRPKLAAWRQRVEAEVGESLFQEAHEVVLK 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 92..211 CDD:198287 28/144 (19%)
Gstt3NP_598755.1 GstA 3..217 CDD:223698 58/230 (25%)
GST_N_Theta 3..78 CDD:239348 24/74 (32%)
Glutathione binding. {ECO:0000250|UniProtKB:P30711} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250|UniProtKB:P30711} 66..67 0/1 (0%)
GST_C_Theta 92..216 CDD:198292 27/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91902320
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.