DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mys45A and AT1G13160

DIOPT Version :8

Sequence 1:NP_610455.1 Gene:Mys45A / 35925 FlyBaseID:FBgn0033379 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_172775.1 Gene:AT1G13160 / 837874 AraportID:AT1G13160 Length:804 Species:Arabidopsis thaliana

Alignment Length:796 Identity:266/797 (33%)
Similarity:400/797 (50%) Gaps:121/797 (15%)


  Fly    12 NLPQLQNLIKRDPESYSDEFHIQYQHFLSLLEVF----ALNPSEE---------NKSLDDIVMFV 63
            :|..||..||||||.|..|..:.|:.|.:.:::|    ||:.|..         :|.|.|..||:
plant    23 SLLTLQGKIKRDPEGYETELQLIYKQFKTSVDLFHELAALSFSSTGGIGSDPSVSKDLGDRAMFL 87

  Fly    64 AQVAQCYPAVCEEFPKRLSDLLKNYATVLDPAMRNCFVKALILLRNKNLVPALDILELFFQLLRC 128
            |.|...||.....||.:|:.||:.....:...:||...:|||||.|:..:...|:|.||..:...
plant    88 AHVTPFYPKQLAAFPAQLTGLLRTSCLAMPSGLRNHIAQALILLMNRKSLVIEDLLALFLDIQTL 152

  Fly   129 PDKNLRTFLQTHIVTDIKNM---NAKHKDMKLNSSLQAFMYSMLKDANPKAAKMSADIMIELYKK 190
            .|||||.....|||..|:.|   :.|||      |||..:.|||:..:...||.:...:..|:||
plant   153 GDKNLRNLAFGHIVQTIRKMSITDPKHK------SLQKIVISMLEQEDEAKAKRALATLCALHKK 211

  Fly   191 NIWNDSKTVNVIATV--GCFSKVTKVLVTSLKFFLGHDEEDEEEDTDSENEVDLKG----ALMAN 249
            .||...|...|...:  .||....::::::|:|.|.::..|:::|:|:|::.|.:.    .::.|
plant   212 KIWLGDKNERVAIAICEACFHSSPRIMISALRFLLDYENIDDDDDSDAESDDDEESKKIDQVVIN 276

  Fly   250 R-----VNKKTKKRTKQLAQIKKQ-AVKAQKKKKNAPAFN----FSGIHLVHNPQGMAEGLFKQL 304
            |     .|.|....:|:..|.|.| |||:.|:|:.:.:.|    ||.::.:::.|..||.||.:|
plant   277 RQAVYKANNKGTSSSKKKKQAKLQRAVKSIKRKQRSSSENTTSTFSPLNHLNDAQKFAEKLFSRL 341

  Fly   305 Q---ATNERFEVKLMHLDVISRLIGIHDLFLFGFYPYITRFLQPHQRQVTRVLQFAAQASHELVP 366
            |   .:.||.|.:||.:.||:|.||:|.|.|..|||::..:..||.:.:|::|..|.|:.|:.||
plant   342 QTIKGSGERVETRLMMIKVIARTIGLHKLHLLSFYPFLQNYALPHVKDITQILAAAVQSCHDGVP 406

  Fly   367 GDIIEPILKTIANNFITERNSSDVMAIGLNATREICMRCPLAMGEDLLQDLAMYKTYKEKSVMMA 431
            .|::||:.|.|.|.|:.:::..:.:|:|||..||:|:|....|.|:||||||:||...||::..|
plant   407 SDVVEPLFKQIVNQFVHDKSRPEAIAVGLNVVREMCLRVHDLMTEELLQDLALYKKSHEKAISAA 471

  Fly   432 ARSLITLYREQLPALLHKKDRGRQTEAQAERKVRAYGEREVHDTVLGAEALLKDSKT-------- 488
            |||||.|:||..|:||.||||||........|  .|||..|...|...| ||::|..        
plant   472 ARSLIALFREINPSLLVKKDRGRPGATVFIPK--HYGESNVFSNVPNVE-LLQESDNESGSDGDQ 533

  Fly   489 ----------IDIE---------SED--DTDSNDGEWVNVAHSDGE---GGGADDDEEDEDEDED 529
                      .|:|         |||  :.|||||:.:|....|.:   ..|.|:|||..|.||.
plant   534 DDDGVELPIGDDVEQELIPGDCGSEDKAEEDSNDGDDMNNTEDDSDIDTSIGGDEDEEVNDSDEA 598

  Fly   530 DDDEDEDEENSNDEENEDEDNSDEGVESG-EESAKAKKEK---KDMRILNQKEAAQELALTR--- 587
            |.|.:.:|..|.:|:.|..|:|.|  :|| :|.||.||.|   .|..:|:...:.:  ||.|   
plant   599 DTDSENEEIESEEEDGEASDSSVE--DSGNKEKAKGKKRKIVDFDANLLSADTSLR--ALKRFAE 659

  Fly   588 -------------IFTDEDFKRINAANLKK--TVTSARK-------RPLEQDRAEFVKLNSIEMI 630
                         |.::|||::|.....||  .:..|||       ..|.:.|.:..||.:    
plant   660 AKNEKPSFDEGDGILSNEDFRKIKTLQAKKEAKIALARKGFKVPNSDQLSKKRVDPAKLEA---- 720

  Fly   631 YKKRKHDKESRLETVQAGRQDRERFGWKDG-RVNEHCSKTNREKRKTKNFGM--LRHKAR----- 687
            :.:.|..||.|||.|:|||:||.::..|.. :..:....:|::|...||..:  :|.||.     
plant   721 HIRHKLTKEQRLELVKAGREDRGKYKSKAAVKQKKTGGSSNKQKEHRKNMPLAAIRSKAGKSKRI 785

  Fly   688 SKVKKSFKDKQQALRK 703
            .|:|.|....|...||
plant   786 KKMKNSISGSQFRGRK 801

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mys45ANP_610455.1 NUC130_3NT 62..111 CDD:285384 18/49 (37%)
SDA1 409..711 CDD:283052 122/365 (33%)
AT1G13160NP_172775.1 NUC130_3NT 86..135 CDD:285384 18/49 (37%)
SDA1 449..802 CDD:283052 122/365 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 340 1.000 Inparanoid score I627
OMA 1 1.010
OrthoDB 1 1.010 D426305at2759
OrthoInspector 1 1.000 T124688
orthoMCL 1 0.900 OOG5_128086
Panther 1 1.100 LDO PTHR12730
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.