DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mys45A and Sdad1

DIOPT Version :8

Sequence 1:NP_610455.1 Gene:Mys45A / 35925 FlyBaseID:FBgn0033379 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001006959.1 Gene:Sdad1 / 289504 RGDID:1359112 Length:686 Species:Rattus norvegicus

Alignment Length:721 Identity:362/721 - (50%)
Similarity:488/721 - (67%) Gaps:57/721 - (7%)


  Fly     5 NNNQLPENLPQLQNLIKRDPESYSDEFHIQYQHFLSLLEVFALNPSEENKSLDDIVMFVAQVAQC 69
            |||:||.|||||||||||||.:|.:||..||.|:.|.:|:|.|.|::.:|.|.::|||:||:..|
  Rat     5 NNNKLPSNLPQLQNLIKRDPPAYVEEFLQQYNHYKSNMEIFKLQPNKPSKELAELVMFMAQIGHC 69

  Fly    70 YPAVCEEFPKRLSDLLKNYATVLDPAMRNCFVKALILLRNKNLVPALDILELFFQLLRCPDKNLR 134
            ||....|||:.|.|||....|||||.:|..|.|||||||||||:...|:|||||:||||.||.||
  Rat    70 YPEHLSEFPQELKDLLSYNHTVLDPDLRMTFCKALILLRNKNLINPSDLLELFFELLRCRDKLLR 134

  Fly   135 TFLQTHIVTDIKNMNAKHKDMKLNSSLQAFMYSMLKDANPKAAKMSADIMIELYKKNIWNDSKTV 199
            ..|.|||||||||:|||||:.|:|..||.|||:||:|:|..|||||.|:|||||::|||||:|||
  Rat   135 KTLYTHIVTDIKNINAKHKNNKVNVVLQNFMYTMLRDSNATAAKMSLDVMIELYRRNIWNDAKTV 199

  Fly   200 NVIATVGCFSKVTKVLVTSLKFFLGHDEEDEEEDTDSENEVD---LKGALMANRVNKKTKKRTKQ 261
            ||| |..||||:||:||.:|.||||.||| |::|:|||:|.|   .:..|:.....||..|..|:
  Rat   200 NVI-TTACFSKITKILVAALTFFLGKDEE-EKQDSDSESEDDGPTARDLLVQYATGKKGSKNKKK 262

  Fly   262 LAQIKKQAVKAQKKKKNAPAFNFSGIHLVHNPQGMAEGLFKQLQATNERFEVKLMHLDVISRLIG 326
            |.:..| .:|.|||||....||||.|||:|:||..||.|.|||::..||||||:|.:::||||:|
  Rat   263 LEKAMK-VLKKQKKKKKPEVFNFSAIHLIHDPQDFAEKLLKQLESCKERFEVKMMLMNLISRLVG 326

  Fly   327 IHDLFLFGFYPYITRFLQPHQRQVTRVLQFAAQASHELVPGDIIEPILKTIANNFITERNSSDVM 391
            ||:||||.|||::.||||||||:||::|.|||||||.|||.:||:.:|.|:||||:|::||.:||
  Rat   327 IHELFLFNFYPFVQRFLQPHQREVTKILLFAAQASHHLVPPEIIQSLLLTVANNFVTDKNSGEVM 391

  Fly   392 AIGLNATREICMRCPLAMGEDLLQDLAMYKTYKEKSVMMAARSLITLYREQLPALLHKKDRGRQT 456
            .:|:||.:||..||||||.|:||||||.|||:|:|:|||:||:||.|:|...|.:|.||.||:.|
  Rat   392 TVGINAIKEITARCPLAMTEELLQDLAQYKTHKDKNVMMSARTLIHLFRTLNPQMLQKKFRGKPT 456

  Fly   457 EAQAERKVRAYGEREVHDTVLGAEALLKDSKTIDIESEDDTDSNDGEWVNVAHSDGEGGGADDDE 521
            ||..|.:::.|||.:..|.:.|||.|       ::|.|::|::::..|.:.:.|           
  Rat   457 EASIEARIQEYGELDAKDYIPGAEVL-------ELEKEENTENDEDGWESASLS----------- 503

  Fly   522 EDEDEDEDDDDEDEDEENSNDEENEDEDNSDEGVESGEESAKAKKEKKDMRILNQKEAAQELALT 586
                 :|::|.|..|..:|:||               |:.|.||| ...|.:..:|..|..::.:
  Rat   504 -----EEEEDGEWVDVHHSSDE---------------EQQAVAKK-LDSMPMEERKAKAAAVSTS 547

  Fly   587 RIFTDEDFKRINAANLKKTVTS----ARKRPL------EQDRAEFVKLNSIEMIYKKRKHDKESR 641
            |:.|.:||::|..|.:||.:.:    |:||..      |:.|.|.:.|..||.::||.|.|||:|
  Rat   548 RVLTQDDFQKIRMAQMKKEMDAAPGKAQKRKYLDMDSDEESRGELLSLRDIERLHKKPKSDKETR 612

  Fly   642 LETVQAGRQDRERFGWKDGRVNEHCSKTNREKRKTKNFGMLRH--KARSKVKKSFKDKQQALRKH 704
            |.|..|||.||:.|..|..::|...|.||:||:|.|||.|:|:  ..|||..:||::||.|||..
  Rat   613 LATAMAGRTDRKEFVRKKTKINPFSSSTNKEKKKQKNFMMMRYSQNVRSKTSRSFREKQLALRDA 677

  Fly   705 LLHQKK 710
            ||.::|
  Rat   678 LLKKRK 683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mys45ANP_610455.1 NUC130_3NT 62..111 CDD:285384 28/48 (58%)
SDA1 409..711 CDD:283052 118/314 (38%)
Sdad1NP_001006959.1 NUC130_3NT 62..111 CDD:285384 28/48 (58%)
SDA1 409..683 CDD:283052 117/312 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150648533
eggNOG 1 0.900 E1_KOG2229
Hieranoid 1 1.000
Homologene 1 1.000 H6036
Inparanoid 1 1.050 666 1.000 Inparanoid score I700
OMA 1 1.010
OrthoDB 1 1.010 D270594at33208
OrthoFinder 1 1.000 FOG0003939
OrthoInspector 1 1.000 T1086732
orthoMCL 1 0.900 OOG5_128086
Panther 1 1.100 LDO PTHR12730
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.