DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mys45A and sda1

DIOPT Version :8

Sequence 1:NP_610455.1 Gene:Mys45A / 35925 FlyBaseID:FBgn0033379 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_595163.1 Gene:sda1 / 2539889 PomBaseID:SPBC106.14c Length:719 Species:Schizosaccharomyces pombe

Alignment Length:747 Identity:258/748 (34%)
Similarity:406/748 (54%) Gaps:85/748 (11%)


  Fly     9 LPENLPQLQNLIKRDPESYSDEFHIQYQHFLSLLEVFALNPSEENKSLDDIVMFVAQVAQCYPAV 73
            ||.|||.||:|:|:||:||.:||..|:.|:.:..|:|.:|||.:......::.|::|....|..|
pombe    10 LPNNLPHLQHLVKKDPKSYREEFLQQWNHYETAREIFLVNPSSDISEFCSLIDFISQTCNYYHDV 74

  Fly    74 CEEFPKRLSDLLKNYATVLDPAMRNCFVKALILLRNKNLVPALDILELFFQLLR-CPDKNLRTFL 137
            ..:||..|.:||:...|:....:....|..|:||:||.::..:.:|:.||.|.| .|.:.:|..|
pombe    75 TADFPSELIELLQKNHTIFPFELCEKIVLCLVLLKNKTVISPITLLQCFFPLFRENPTRGVRELL 139

  Fly   138 QTHIVTDIKNMNAKHKDMKLNSSLQAFMYSMLKDANP---------------KAAKMS----ADI 183
            ...:...|:|.|.:.|:.|||.::|:.:::::..:..               .|:::|    ..:
pombe   140 YQQVSLTIRNANKQAKNDKLNKAVQSALFTLVDGSGSGSATHTDYSGQKREYSASELSGVWAVKM 204

  Fly   184 MIELYKKNIWN-DSKTVNVIATVGCFSKVTKVLVTSLKFFLGHDEEDEEEDTDSENEVDLKGALM 247
            :.:|:|:|:|: |::.||::.: ...|...||::..:.||||.|.::|||::|.|.. |:...|.
pombe   205 VRDLWKRNVWSGDARAVNIMKS-AALSSNPKVMLAGIYFFLGADNQEEEEESDDEGP-DVSKLLH 267

  Fly   248 ANRVNKKTKKRTKQLAQIKKQAVKAQKKKKNAPA-FNFSGIHLVHNPQGMAEGLF-KQLQATNER 310
            ...||||||.|...|.:.:....|.::.|:|.|. .||..:.|:|:|||.||.|| |.|.::..|
pombe   268 QANVNKKTKSREAALLRARAVVKKKERGKQNVPTNVNFPALQLLHDPQGFAEELFEKHLASSKSR 332

  Fly   311 FEV--KLMHLDVISRLIGIHDLFLFGFYPYITRFLQPHQRQVTRVLQFAAQASHELVPGDIIEPI 373
            ..:  ||:.|.:::||:|.|.|.:.|.|.::.::|.||||.||:.|...||||||.||.|.:||:
pombe   333 LSMDQKLVVLRLLTRLVGSHKLTVLGLYSFLMKYLTPHQRDVTQFLACLAQASHEFVPPDALEPL 397

  Fly   374 LKTIANNFITERNSSDVMAIGLNATREICMRCPLAMGEDLLQDLAMYKTYKEKSVMMAARSLITL 438
            ::.||:.|:|...:::|:..|:||.||:|.|.||||..||||||..||:.|:|.||||:||||||
pombe   398 VRKIADEFVTSGVANEVVCAGINAIREVCARAPLAMTPDLLQDLTEYKSSKDKGVMMASRSLITL 462

  Fly   439 YREQLPALLHKKDRGRQTEAQAERKVRAYGEREVHDTVLGAEALLKDSKTIDIESEDDTDSNDGE 503
            |||..|.:|.:||||                                 |...||.:|.|....||
pombe   463 YREVAPDMLKRKDRG---------------------------------KLASIEMKDRTPLKYGE 494

  Fly   504 WVNVAHSDGEGG-------GADDDEEDEDEDEDDDDE-DEDEENSNDEENEDEDNSDEGVE---- 556
            .:||.|  |..|       .|:..||.|:.|:.|:.| .||.:||:|.....:.:||:.:|    
pombe   495 ELNVTH--GIQGLELLAQYKAEHGEEGENGDDWDNWEVSEDGQNSDDSGGWIDVDSDDNIELSDS 557

  Fly   557 -SGEESAKAKKEKKDMRILNQKEAAQ---ELALTRIFTDEDFKRI----NAANLKKTVTSARKRP 613
             ..||.|.|:||..:....:|||...   |||...|.|..|.|::    ..|.:.:.|...::..
pombe   558 DEEEEKATARKESDEKGSSSQKELVDRMTELASQSILTPNDLKKLEELREQAGVDRLVNGPKRSL 622

  Fly   614 LEQDRAEFVKLNSIEMIYKKRKHDKESRLETVQAGRQDRERFGWKDGRVNEHCSKTNREKRKTKN 678
            ...|.|  |:.:.||...||.|:|:|:|:.:|..||:.|::|..|....|. .|.:|:.|::.||
pombe   623 KRPDDA--VEADEIEGPRKKAKNDREARIASVMEGREGRDKFSSKKAGFNP-TSLSNKRKQRNKN 684

  Fly   679 FGMLRHKARSKVKKSFKDKQQALRKHLLHQKK 710
            |.|::||.:.|..:|...||:.||:|:..:|:
pombe   685 FMMIKHKLKGKAGRSLVQKQKVLREHVAREKR 716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mys45ANP_610455.1 NUC130_3NT 62..111 CDD:285384 16/49 (33%)
SDA1 409..711 CDD:283052 110/323 (34%)
sda1NP_595163.1 NUC130_3NT 63..111 CDD:285384 15/48 (31%)
SDA1 433..717 CDD:283052 110/323 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 402 1.000 Inparanoid score I369
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003939
OrthoInspector 1 1.000 T1124738
orthoMCL 1 0.900 OOG5_128086
Panther 1 1.100 LDO PTHR12730
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1296
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.