DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mys45A and pro-3

DIOPT Version :8

Sequence 1:NP_610455.1 Gene:Mys45A / 35925 FlyBaseID:FBgn0033379 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_741684.2 Gene:pro-3 / 180256 WormBaseID:WBGene00012676 Length:801 Species:Caenorhabditis elegans

Alignment Length:778 Identity:284/779 (36%)
Similarity:430/779 (55%) Gaps:101/779 (13%)


  Fly    12 NLPQLQNLIKRDPESYSDEFHIQYQHFLSLLEVFALNPS---EENKSLDDIVMFVAQVAQCYPAV 73
            ||..:|.:|::|||||.:||..|:.:|:..:::..|.|.   :|.:||.|.|:|::.:|:.||..
 Worm    46 NLGLMQEIIRKDPESYKEEFLEQFNYFVQTMKLLHLQPEQSRQEMQSLVDSVLFLSGLAKHYPKE 110

  Fly    74 CEEFPKRLSDLLKNYATVLDPAMRNCFVKALILLRNKNLVPALDILELFFQLLRCPDKNLRTFLQ 138
            .::|...|.:||:.....|||.:|..|.|||:||||::::..:.::|.||:|::..||.||.||.
 Worm   111 SKQFSDSLFELLREQGAGLDPEVRMAFCKALVLLRNQDMIDPIILMETFFELVKVEDKVLRKFLL 175

  Fly   139 THIVTDIKNMNAKHKDMKLNSSLQAFMYSMLKDANPKAAKMSADIMIELYKKNIWNDSKTVNVIA 203
            :.|...:|.:..|.||:|:...:|...:|.:||:....|:.:..:.|:.:::..|.|::|.||||
 Worm   176 SSISAHLKRVYHKKKDVKMLGKIQNLCFSKMKDSRSIVARAAQLVCIDAFRRKFWRDARTANVIA 240

  Fly   204 TVGCFSKVTKVLVTSLKFFLGHD------EEDEEEDTDSE-NEVDLKGALMANRVNKKTKKRTKQ 261
            . .||.||.|:.|||:|||||.:      |:.:|.|:|:| |...||..:.:.|..|||:||.|.
 Worm   241 Q-ACFHKVAKIQVTSMKFFLGSENENGDAEDSDEMDSDAEDNTKTLKEVMTSFRNVKKTRKREKN 304

  Fly   262 LAQIKKQAVKAQKKKK--NAPAFNFSGIHLVHNPQGMAEGLFKQLQATN-ERFEVKLMHLDVISR 323
            :.:.||...|.:|.||  .:...|...|..:::||...:.||..::|.. :.|||:|..:.:.:|
 Worm   305 VERAKKMISKKKKAKKEGRSKECNLMAIQSLYDPQEFVDRLFGAVEAKKMDNFEVRLFKIALCAR 369

  Fly   324 LIGIHDLFLFGFYPYITRFLQPHQRQVTRVLQFAAQASHELVPGDIIEPILKTIANNFITERNSS 388
            :||||.|....||.|:.|||||.||.||::|.:||||.||:||.|.:|.:::.|||||:|:|||.
 Worm   370 IIGIHRLHTLSFYSYLHRFLQPKQRDVTKILLYAAQACHEMVPPDTVEQLIRVIANNFVTDRNSP 434

  Fly   389 DVMAIGLNATREICMRCPLAMGEDLLQDLAMYKTYKEKSVMMAARSLITLYREQLPALLHKKDRG 453
            :.|.:|:||.|||...||.|..|:||:||:.|||||.|:|.|||||||||:|...|.||.:||||
 Worm   435 EAMTVGINAIREILSNCPFAATEELLRDLSEYKTYKNKNVSMAARSLITLFRAVNPKLLARKDRG 499

  Fly   454 RQTEAQAE-RKVRAYGEREVHDTVLGAEAL----------------------LKDSKTIDIESED 495
            :..|...| .:...:...:|||.:.|||.|                      :.|..|.|::::|
 Worm   500 KPQEKDDEDEEYNGFARPKVHDFISGAEILDEDAADGEQGHLEEDGTDSELDVSDVDTDDVDTDD 564

  Fly   496 DTD--------------SNDGEWVNVAHSDGEGGGADDDEEDEDEDEDDDDEDEDEENSNDEENE 546
            |.|              .||.|      ||.      ||||.|||:|.||:|:|.|.:..:||..
 Worm   565 DADEPVAKKKRVEQKSVENDAE------SDA------DDEEIEDEEEMDDEEEEIEISDEEEEEI 617

  Fly   547 DEDNSDEGVESGEESAKAKKEKKDMRILNQKEAAQELALTRIFTDEDFKRINAANLKKTVTS--- 608
            |::..:|.|...|.|...:|:        .|..|.:.::.||.|.||||.|.|..|||.:..   
 Worm   618 DDEAEEEAVVEEEASEAVEKD--------PKLKASKNSMDRIMTQEDFKNIKAYQLKKQLIGEKR 674

  Fly   609 --------------------ARKRPLEQDRAEFVKLNSIEMIYKKRKHDKESRLETVQAGRQDRE 653
                                |.|..|::......:|:.||..|||::..||.|:..|.|||.|.:
 Worm   675 LKKQMGKGRSQADERIVDEMAEKLELKRSSDGLARLSDIEHFYKKKRQSKEERMADVMAGRADED 739

  Fly   654 RFGWKDGRVNE---HCSKTNREKRKTKNFGMLRHKARSKVK-KSFKDKQQALRKHLLHQKKMK 712
               :|.||..:   |..:||.:..|.|.|.|:::|.|.:.: :||:|:|::||.:|:.|...|
 Worm   740 ---YKFGRPKKNGAHVGRTNDQNSKKKVFAMVKNKIRGRNRQRSFRDQQKSLRHYLMRQSGRK 799

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mys45ANP_610455.1 NUC130_3NT 62..111 CDD:285384 20/49 (41%)
SDA1 409..711 CDD:283052 121/366 (33%)
pro-3NP_741684.2 NUC130_3NT 99..148 CDD:285384 20/49 (41%)
SDA1 456..795 CDD:283052 120/362 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150653435
eggNOG 1 0.900 E1_KOG2229
Hieranoid 1 1.000
Homologene 1 1.000 H6036
Inparanoid 1 1.050 464 1.000 Inparanoid score I853
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D270594at33208
OrthoFinder 1 1.000 FOG0003939
OrthoInspector 1 1.000 T474411
orthoMCL 1 0.900 OOG5_128086
Panther 1 1.100 LDO PTHR12730
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1296
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.