DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mys45A and sdad1

DIOPT Version :8

Sequence 1:NP_610455.1 Gene:Mys45A / 35925 FlyBaseID:FBgn0033379 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001095942.1 Gene:sdad1 / 100124509 XenbaseID:XB-GENE-1008732 Length:689 Species:Xenopus tropicalis

Alignment Length:730 Identity:364/730 - (49%)
Similarity:489/730 - (66%) Gaps:73/730 - (10%)


  Fly     5 NNNQLPENLPQLQNLIKRDPESYSDEFHIQYQHFLSLLEVFALNPSEENKSLDDIVMFVAQVAQC 69
            |||:||.|||||||||||||.||.:||..||:|:||::|:|.|.|.:.||.|..:|||:||.|.|
 Frog     5 NNNKLPTNLPQLQNLIKRDPTSYREEFLQQYKHYLSVIEIFKLQPDKPNKELSTLVMFMAQTAHC 69

  Fly    70 YPAVCEEFPKRLSDLLKNYATVLDPAMRNCFVKALILLRNKNLVPALDILELFFQLLRCPDKNLR 134
            :|...|:||::|..||:.:.||:||..|....|||||||||||:....:|||||:||||.||.||
 Frog    70 FPQYLEDFPEQLKSLLRVHHTVMDPDQRMTLCKALILLRNKNLISPSVLLELFFELLRCQDKLLR 134

  Fly   135 TFLQTHIVTDIKNMNAKHKDMKLNSSLQAFMYSMLKDANPKAAKMSADIMIELYKKNIWNDSKTV 199
            ..|.|||||||||:|||||:.|:|::||.|||:|::|.|..|||:|.|:|||||::|||||:|||
 Frog   135 KTLYTHIVTDIKNINAKHKNNKVNTTLQNFMYTMVRDNNAIAAKISLDVMIELYRRNIWNDAKTV 199

  Fly   200 NVIATVGCFSKVTKVLVTSLKFFLGHDEEDEEEDTDSENEVD---LKGALMANRVNKKTKKRTKQ 261
            |||:| .|||||||:||.:||||||.||| |::|:|||:|.:   .:..::.....||..|..|:
 Frog   200 NVIST-SCFSKVTKILVAALKFFLGKDEE-EKKDSDSESEDEGPTARDLMVRYSTGKKNTKNKKK 262

  Fly   262 LAQIKKQAVKAQKKKKNAPAFNFSGIHLVHNPQGMAEGLFKQLQATNERFEVKLMHLDVISRLIG 326
            |.:..| .:|..||||....||||.|||||:||..||.|.|||:|:.|||||||||:|:||||:|
 Frog   263 LEKAMK-VLKKHKKKKRPEVFNFSAIHLVHDPQEFAEKLLKQLEASKERFEVKLMHMDLISRLVG 326

  Fly   327 IHDLFLFGFYPYITRFLQPHQRQVTRVLQFAAQASHELVPGDIIEPILKTIANNFITERNSSDVM 391
            ||:||||.|||::.||||||||:||::|.:||||:|.|||.:|.:.:|:||||||:|:|||.:||
 Frog   327 IHELFLFNFYPFVQRFLQPHQREVTKILLYAAQATHHLVPPEISQSVLRTIANNFVTDRNSGEVM 391

  Fly   392 AIGLNATREICMRCPLAMGEDLLQDLAMYKTYKEKSVMMAARSLITLYREQLPALLHKKDRGRQT 456
            .:|:||.:|:..||||||.|:||||||:|||:|:|:|.|:|||||.|:|...|.:|.||.||:.|
 Frog   392 TVGINAIKELTARCPLAMTEELLQDLALYKTHKDKNVSMSARSLIQLFRSLNPEMLQKKFRGKPT 456

  Fly   457 EAQAERKVRAYGEREVHDTVLGAEAL-LKDSKTIDIESED-------DTDSNDGEWVNVAHSDGE 513
            ||..|.::.||||.:..|.:.|||.| ::..||.:.|.:|       ..|..||||::|.|    
 Frog   457 EASKEARIHAYGELDAKDYIPGAEVLEVEQEKTEEPEEDDGWESASLSDDDEDGEWIDVHH---- 517

  Fly   514 GGGADDDEEDEDEDEDDDDEDEDEENSNDEENEDEDNSDEGVESGEESAKAKKEKKDMRILNQKE 578
                                      |:|||.::..:..:.:.:.|..||               
 Frog   518 --------------------------SSDEEQQEVADKIQAMPAEERKAK--------------- 541

  Fly   579 AAQELALTRIFTDEDFKRINAANLKKTVTSA-----RKRPLEQD------RAEFVKLNSIEMIYK 632
             |..::.:|:.:.||||:|..|.|.|.:.:|     :::.:|.|      ..|.:.|..||.::|
 Frog   542 -AATVSASRLLSQEDFKKIRLAQLAKEMNNAPGKSVKRKNIEIDSDEEERSGELLSLRDIEHLHK 605

  Fly   633 KRKHDKESRLETVQAGRQDRERFGWKDGRVNEHCSKTNREKRKTKNFGMLRH--KARSKVKKSFK 695
            |.|.|||:||.||.|||.||:.|..|..::|.|.|.||:||:|.|||.|:|:  ..|||.|:||:
 Frog   606 KPKSDKETRLATVMAGRTDRKEFVRKKSKMNPHASSTNKEKKKNKNFMMMRYSQNIRSKNKRSFR 670

  Fly   696 DKQQALRKHLLHQKK 710
            |||.|||..||.::|
 Frog   671 DKQIALRDSLLKKRK 685

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mys45ANP_610455.1 NUC130_3NT 62..111 CDD:285384 25/48 (52%)
SDA1 409..711 CDD:283052 121/323 (37%)
sdad1NP_001095942.1 NUC130_3NT 62..111 CDD:285384 25/48 (52%)
SDA1 409..685 CDD:283052 120/321 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C150648370
eggNOG 1 0.900 E1_KOG2229
Hieranoid 1 1.000
Homologene 1 1.000 H6036
Inparanoid 1 1.050 675 1.000 Inparanoid score I659
OMA 1 1.010
OrthoDB 1 1.010 D270594at33208
OrthoFinder 1 1.000 FOG0003939
OrthoInspector 1 1.000 T601111
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1296
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.