DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vang and vang-1

Sequence 1:NP_001260819.1 Gene:Vang FlyBaseID:FBgn0015838 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_508500.1 Gene:vang-1 WormBaseID:WBGene00015171 Length:532 Species:Caenorhabditis elegans

Alignment Length:526 Identity:167/527 (32%)
Similarity:268/527 (51%) Gaps:75/527 (14%)


  Fly    86 DGQEVIEVQILPQDENWGENTTAVTGNTSEQSISMED-------INNMWHRESDKGFSFACRRYV 143
            :||     :|.|.:|:|.:|||.:||.|:: |.:||:       |..:..|.        |.|:|
 Worm    52 EGQ-----KIAPPNEDWADNTTVLTGMTTD-SFTMEEKVIYTPPIGRVIGRR--------CSRFV 102

  Fly   144 ---ESSFYFLLGCGAFFSPVAM---VVMPYVGFFPSAFDHPEITQTVRTQLLACSEQCKGQLVSL 202
               .||...::  ....:|:..   ::.|..||...|              :.|...|:|.|..:
 Worm   103 WLLASSLLCII--SVVSAPIMCSLPIIAPRFGFSMPA--------------IQCDVDCEGLLFLM 151

  Fly   203 AARLLLLAIGLWAVFMRRTSATMPRIFLYRALVLLLVTICTFAYWLFYIVQVTNGAKIVVETGGD 267
            |.:.:.|.|.:..::.|:..|.|||::..||.:..||....||:||||||      :|:.|... 
 Worm   152 AIKTIFLVIAIGVLYWRKAMADMPRLYFVRAALTFLVMFILFAFWLFYIV------RIMFERYD- 209

  Fly   268 AVDYKSLVGYATNFVDTLLFIHYVAVVLLELRHQQPCYYIKIIRSPDGVSRSYMLGQLSIQRAAV 332
              :||.:|.|:|:.:|.||:.||::|||||||..:..:.:.|:|.|||...:..:|..|||.||.
 Worm   210 --NYKYIVSYSTSLLDALLWTHYLSVVLLELRRLRAQFIVTIVRDPDGEMHTLNIGAGSIQEAAT 272

  Fly   333 WVLQHYYVDFPIFNPYLE--RIPISVSKSQRNKISNSFKYYEVD--GVSNSQQQSQSRAVLAANA 393
            .:|:.|...|..||.:|:  |......:|.....:..||.|.::  |...:..:..:||::.|.|
 Worm   273 EILRFYTTRFSSFNIHLDNARQTAVAKQSGMQGGTAGFKMYNIEQFGGQETVSEVNTRALMEAAA 337

  Fly   394 RRRDSSHNERFYEEHEYERRVKKRRARLITAAEEAFTHIKR-----IHNEPAPALPLDPQEAASA 453
            |||...:.|...||.::|:|:|||:.|||.|||:||:|::.     .:.:|.....:|...||..
 Worm   338 RRRIGGYAEVMQEELDFEKRLKKRKYRLIAAAEDAFSHVQNTAESGTNQKPGINNQMDSLTAAQN 402

  Fly   454 VFPSMARALQKYLRVTRQQPRHTFESILKHLAHCLKHDLSPRAFLEPYLTES-PVMQSEKERRWV 517
            ||..:.|.|.|||:.||.|.||....:.:|:..||...||.|.||:.:.::. |    ::|....
 Worm   403 VFTWIVRPLTKYLKTTRLQSRHPSGEVTRHIERCLTLKLSHRTFLQRFFSDRIP----QREIVGE 463

  Fly   518 QSWSLICDEIVSRPIGNECTFQLIQN-------DVSLMVTVHKLPHFNLAEEVVDPKSNKFVLKL 575
            ..||:||||.||..: ...|:.::::       .|.|:.|:..:|.|||.|: ..|.:.||.||:
 Worm   464 SKWSVICDEAVSSGV-QHGTYLVLKSHNPDIDCGVQLVCTISSIPFFNLTEQ-AKPGNEKFSLKI 526

  Fly   576 NSETSV 581
            ::|::|
 Worm   527 SNESAV 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VangNP_001260819.1 Strabismus 44..581 CDD:284135 166/525 (32%)
vang-1NP_508500.1 Strabismus 44..532 CDD:284135 166/525 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C14247228
eggNOG 1 0.900 E1_KOG3814
Hieranoid 1 1.000
Homologene 1 1.000 H44540
Inparanoid 1 1.050 235 1.000 Inparanoid score I2119
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1325060at2759
OrthoFinder 1 1.000 FOG0002881
OrthoInspector 1 1.000 T475293
orthoMCL 1 0.900 OOG5_131707
Panther 1 1.100 LDO PTHR20886
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4213
TreeFam 1 0.960
1312.890

Return to query results.
Submit another query.