DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8197 and lrrc34

Sequence 1:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_001919301.4 Gene:lrrc34 ZFINID:ZDB-GENE-091118-73 Length:410 Species:Danio rerio

Alignment Length:323 Identity:74/324 (23%)
Similarity:130/324 (40%) Gaps:39/324 (12%)


  Fly    60 RYHCIRDLRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDFVRSLLPVWYIELRLMRFPREFFVM 124
            ||:||.|...:....|.:...|:|...|:.::.:|...:...:||                    
Zfish    73 RYNCITDKGAVHIAHLIQDSKSLQSLDLMCNDIEADGAEVIAKSL-------------------- 117

  Fly   125 LRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSL-TQFNFALIADGVYKSP 188
                ...:.:..|.:.|..:.::....|...|.::.||..::||.|.| ||   ::||..:....
Zfish   118 ----HKNITLKTLRMTGNKIGNQGAMQLATMLQINATLEEVDVSDCDLATQ---SVIAFAIVLMN 175

  Fly   189 GVRRLSANRLLGMSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNSKFR 253
            ..|..:.|....:..||..|....:...|::.|||..|.:...::|...:..:.|.|.| |...|
Zfish   176 NKRICAINVSRPLLFSLQEETTVHMAQMLVVNNTLKELHMGKHDMTDTGVETLCEALKR-NISLR 239

  Fly   254 RLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLASC-----RRLQVLHL 313
            .|.:.||:|..|||..|...:....:||:||||:..|...|    |.:|:..     .:|:.|.:
Zfish   240 YLDLCCNRITRDGAKHLSEVLKQNCSLEILDLSFNCIEDVG----AIHLSEAIKLPHSKLKALSV 300

  Fly   314 NYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDIS-YTYD 375
            ..|.:....:..:..||:....|..:.::||..:.........|:.:..:|....|:| |..|
Zfish   301 TSNKIRKGGLLSLSAAMRVNSSLTHIYIWGNKHEEPVCEAFSGLMSSGRLLKEHTDVSPYEVD 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 4/27 (15%)
LRR_RI 137..374 CDD:238064 61/244 (25%)
leucine-rich repeat 162..189 CDD:275381 9/28 (32%)
leucine-rich repeat 202..220 CDD:275380 4/18 (22%)
leucine-rich repeat 223..251 CDD:275380 7/28 (25%)
leucine-rich repeat 252..279 CDD:275380 9/27 (33%)
leucine-rich repeat 280..307 CDD:275380 10/32 (31%)
leucine-rich repeat 308..335 CDD:275380 5/27 (19%)
leucine-rich repeat 336..357 CDD:275380 3/21 (14%)
lrrc34XP_001919301.4 leucine-rich repeat 67..94 CDD:275381 6/21 (29%)
LRR_RI <95..332 CDD:238064 61/269 (23%)
leucine-rich repeat 95..122 CDD:275380 5/51 (10%)
leucine-rich repeat 123..150 CDD:275380 4/27 (15%)
leucine-rich repeat 151..178 CDD:275380 9/30 (30%)
leucine-rich repeat 179..202 CDD:275380 4/23 (17%)
leucine-rich repeat 210..237 CDD:275380 7/28 (25%)
LRR_8 237..305 CDD:290566 22/72 (31%)
leucine-rich repeat 238..265 CDD:275380 9/27 (33%)
leucine-rich repeat 266..292 CDD:275380 10/30 (33%)
leucine-rich repeat 323..344 CDD:275380 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5306
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005729
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.