DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8197 and Lrrc31

Sequence 1:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_017446722.1 Gene:Lrrc31 RGDID:1561499 Length:627 Species:Rattus norvegicus

Alignment Length:334 Identity:81/335 (24%)
Similarity:120/335 (36%) Gaps:121/335 (36%)


  Fly    99 DFVRSLLPVWYIELRLMRFPREFFVML--RLNAAKMNVSQLSLEGTP-----------LTDEDVR 150
            :||..|||    :|:.:    |.|.:.  |...:.:::....|:.||           |:.:.||
  Rat   291 EFVGHLLP----KLQSL----EVFDLSNNRNIGSSLDIIAQGLKSTPGLKILKLHSCGLSPKSVR 347

  Fly   151 IL----------------------REF------LLVSKTLRRLNVSSCSLTQFNFALIADGVYKS 187
            ||                      |.|      |.:.|.|..|::..||||..:...:...|...
  Rat   348 ILDGAFAFLDALRILDLSCNKELGRGFEEVPARLALLKHLEVLDLHQCSLTAEDVTSLTQIVPLL 412

  Fly   188 PGVRR--LSANRLLGMSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNS 250
            ..:..  ||:||.||.||       .|:||.|....:|.:|.:..|.|..:....:||......:
  Rat   413 SNLEELDLSSNRALGGSL-------ESLLSRLRFLPSLKSLLINSCALQRESFTALAEASVYLPA 470

  Fly   251 KFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLD-------------LSYCSIGTHGGEWVA--- 299
             ...|.::.||             .:|||||||.             ||.||:.|.....:|   
  Rat   471 -LEILDLSWNK-------------CVGGNLELLQQTLNLSRSLRELRLSSCSLVTEDVALLALVM 521

  Fly   300 --KYLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEV 362
              .:||:   ||.|.|:||| |.......:.. :..|:|::||                      
  Rat   522 QTGHLAT---LQKLDLSYND-GICDAGWAIFC-QNLCRLKELT---------------------- 559

  Fly   363 VLHSELDIS 371
                |||||
  Rat   560 ----ELDIS 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 12/66 (18%)
LRR_RI 137..374 CDD:238064 72/295 (24%)
leucine-rich repeat 162..189 CDD:275381 7/27 (26%)
leucine-rich repeat 202..220 CDD:275380 6/18 (33%)
leucine-rich repeat 223..251 CDD:275380 6/28 (21%)
leucine-rich repeat 252..279 CDD:275380 5/27 (19%)
leucine-rich repeat 280..307 CDD:275380 12/45 (27%)
leucine-rich repeat 308..335 CDD:275380 9/27 (33%)
leucine-rich repeat 336..357 CDD:275380 3/21 (14%)
Lrrc31XP_017446722.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.