DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8197 and Nlrp4b

Sequence 1:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001342080.1 Gene:Nlrp4b MGIID:3056570 Length:863 Species:Mus musculus

Alignment Length:214 Identity:56/215 (26%)
Similarity:104/215 (48%) Gaps:33/215 (15%)


  Fly    83 QISSLVVSNWDAGLLK----DFVRSLLPVWYIELR--------LMRFPREFFVMLRL---NAAKM 132
            ||.|:.:.|.|...|:    .|...:..::|..|:        |:.:...|....||   .....
Mouse   620 QICSVFLRNKDIKTLRIEDTIFNEPVFKIFYSYLKNSSCILKTLVAYNVSFLCDKRLFLELIQSY 684

  Fly   133 NVSQLSLEGTPLTDEDVRILREFLLVSK-TLRRLNVSSCSLTQFNFALIADGVYKSPGVR--RLS 194
            |:.:|.|.||.|:..||.:|.:.|..:: .:|.|::::|||.:.::..::|.:.::..:|  .:|
Mouse   685 NLEELYLRGTFLSHSDVEMLCDILNQAECNIRILDLANCSLCEHSWDYLSDVLRQNKSLRYLNIS 749

  Fly   195 ANRLLGMSLSLDTEKISSVLSSLLMQNT-LWALSLEHCELTAQDMIPIAEHLARTNSKF---RRL 255
            .|       :|..|.:.::..:|.:.|: |.:||||.|:||.    ...:.||.|.:::   ||:
Mouse   750 YN-------NLKDEGLKALCRALTLPNSALHSLSLEACQLTG----ACCKDLASTFTRYKCLRRI 803

  Fly   256 RIACNKIGPDGAFFLLRGM 274
            .:|.|.:|..|.|.|.:.|
Mouse   804 NLAKNSLGFSGLFVLCKAM 822

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 9/28 (32%)
LRR_RI 137..374 CDD:238064 42/146 (29%)
leucine-rich repeat 162..189 CDD:275381 6/27 (22%)
leucine-rich repeat 202..220 CDD:275380 3/18 (17%)
leucine-rich repeat 223..251 CDD:275380 11/28 (39%)
leucine-rich repeat 252..279 CDD:275380 9/27 (33%)
leucine-rich repeat 280..307 CDD:275380
leucine-rich repeat 308..335 CDD:275380
leucine-rich repeat 336..357 CDD:275380
Nlrp4bNP_001342080.1 Pyrin_NALPs 10..93 CDD:260032
NACHT 145..311 CDD:310381
LRR_RI 601..834 CDD:330982 56/215 (26%)
LRR 1 618..643 7/23 (30%)
LRR 2 683..706 9/23 (39%)
leucine-rich repeat 686..709 CDD:275380 9/23 (39%)
leucine-rich repeat 715..742 CDD:275380 6/27 (22%)
LRR 3 717..740 5/23 (22%)
LRR 4 741..763 5/29 (17%)
LRR 5 765..782 8/17 (47%)
leucine-rich repeat 772..799 CDD:275380 11/31 (35%)
LRR 6 797..824 9/27 (33%)
leucine-rich repeat 800..821 CDD:275380 8/21 (38%)
LRR 7 843..863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.