DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8197 and NLRP4

Sequence 1:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_604393.2 Gene:NLRP4 HGNCID:22943 Length:994 Species:Homo sapiens

Alignment Length:330 Identity:85/331 (26%)
Similarity:140/331 (42%) Gaps:41/331 (12%)


  Fly    75 LRRPQLSVQISSLVVSN----WDAGLLKDFVRSLLPVWYIELRLMRFPREFFVML--RLNAAKMN 133
            ||.|  |.::..|.::|    ..:.||.:.:.....:.|:...|.:..|:....|  .||....|
Human   662 LRHP--SCRLQKLGINNVSFSGQSVLLFEVLFYQPDLKYLSFTLTKLSRDDIRSLCDALNYPAGN 724

  Fly   134 VSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGV-------------- 184
            |.:|:|....|:..|..:|...|..:|.|..||| ||:.......|:.:.:              
Human   725 VKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNV-SCNQLDTGVPLLCEALCSPDTVLVYLMLAF 788

  Fly   185 ---------YKSPGVRRLSANRLLGMSLS-LDTEKISSVLSSLLMQN-TLWALSLEHCELTAQDM 238
                     |.|..:.|..:.|.|.:|.: |..|.:.::..:|...: .|.:|.|..|.:||...
Human   789 CHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKHPDCCLDSLCLVKCFITAAGC 853

  Fly   239 IPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMS-MGGNLELLDLSYCSIGTHGGEWVAKYL 302
            ..:|..|. :|...:.|:|.||:||..|...|.|.:: ....||:|.|..|.:.:...:.:|..|
Human   854 EDLASALI-SNQNLKILQIGCNEIGDVGVQLLCRALTHTDCRLEILGLEECGLTSTCCKDLASVL 917

  Fly   303 ASCRRLQVLHLNYNDMGPTAVNLILLAMK-KQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHS 366
            ...:.||.|:|..|.:..|.|.::..|:: .:|.|:.|.|....||..|    :.||.||...:.
Human   918 TCSKTLQQLNLTLNTLDHTGVVVLCEALRHPECALQVLGLRKTDFDEET----QALLTAEEERNP 978

  Fly   367 ELDIS 371
            .|.|:
Human   979 NLTIT 983

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 8/27 (30%)
LRR_RI 137..374 CDD:238064 69/263 (26%)
leucine-rich repeat 162..189 CDD:275381 9/50 (18%)
leucine-rich repeat 202..220 CDD:275380 4/19 (21%)
leucine-rich repeat 223..251 CDD:275380 9/28 (32%)
leucine-rich repeat 252..279 CDD:275380 9/28 (32%)
leucine-rich repeat 280..307 CDD:275380 7/27 (26%)
leucine-rich repeat 308..335 CDD:275380 9/28 (32%)
leucine-rich repeat 336..357 CDD:275380 6/21 (29%)
NLRP4NP_604393.2 Pyrin_NALPs 11..92 CDD:260032
AAA 147..279 CDD:214640
NACHT 149..318 CDD:283404
CS_ACL-C_CCL 512..>570 CDD:294291
LRR_RI <630..733 CDD:238064 18/73 (25%)
LRR 1 637..660
leucine-rich repeat 640..668 CDD:275380 4/8 (50%)
leucine-rich repeat 669..695 CDD:275380 4/26 (15%)
leucine-rich repeat 696..724 CDD:275380 6/28 (21%)
LRR 2 698..721 6/23 (26%)
LRR 3 722..745 7/23 (30%)
LRR_RI 724..957 CDD:238064 61/235 (26%)
leucine-rich repeat 725..752 CDD:275380 8/27 (30%)
LRR 4 750..777 8/28 (29%)
leucine-rich repeat 753..780 CDD:275380 7/28 (25%)
leucine-rich repeat 781..808 CDD:275380 3/27 (11%)
LRR 5 806..833 6/27 (22%)
leucine-rich repeat 809..833 CDD:275380 6/24 (25%)
leucine-rich repeat 838..865 CDD:275380 9/28 (32%)
LRR 6 863..886 9/23 (39%)
leucine-rich repeat 895..922 CDD:275381 7/27 (26%)
LRR 7 920..943 7/23 (30%)
LRR 8 949..972 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1072184
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.