DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8197 and nlrc5

Sequence 1:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_003200494.2 Gene:nlrc5 ZFINID:ZDB-GENE-080429-2 Length:1746 Species:Danio rerio

Alignment Length:287 Identity:67/288 (23%)
Similarity:118/288 (41%) Gaps:86/288 (30%)


  Fly   127 LNAAKM--------NVSQLSLEGTPLTDEDVRILREFLLVSKTLRRL-NVSSCSLTQFNFALIAD 182
            :.|||:        |::.|::....|.||.:|.:.|      |:.|| |:||..:.:.|.:  .|
Zfish   732 VGAAKLAKALEDCPNITHLNVSDNSLKDEGIREIAE------TVSRLHNISSILMGKNNIS--TD 788

  Fly   183 GVYKSPGVRRLSA-----------NRLLGMSLSLDTEKISSVLSSLLMQNT--LWALSLEHCELT 234
            |:...  :.|::|           |:.:.:|.|..::.||   .|..::||  ...:.|:.|.||
Zfish   789 GILTL--IERMAACTSVQEVHVEGNKEINLSFSKRSDTIS---ESKDLKNTEETKNIILKQCNLT 848

  Fly   235 AQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVA 299
                   ..|:|.          .|||         |||.::   |.|||||..|:|..|.:.:.
Zfish   849 -------VSHVAS----------LCNK---------LRGFAI---LTLLDLSNNSLGNKGLKKIL 884

  Fly   300 KYLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGN-------HFD---------- 347
            ..|.....:|.::::.|.:....|.::..|:.||..|:::....|       .||          
Zfish   885 DLLPKLGGIQEINVSENGVDMEGVVMLASALCKQYNLKRVDASENGKKKVVLGFDTTRGHNSGEL 949

  Fly   348 --SRTAMIVRRLLDAEVVLHSELDISY 372
              :.|.|.:.:.|.   :.||::..:|
Zfish   950 TQNETGMQLHKKLS---LTHSDIQPAY 973

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 6/27 (22%)
LRR_RI 137..374 CDD:238064 63/270 (23%)
leucine-rich repeat 162..189 CDD:275381 8/28 (29%)
leucine-rich repeat 202..220 CDD:275380 5/18 (28%)
leucine-rich repeat 223..251 CDD:275380 6/28 (21%)
leucine-rich repeat 252..279 CDD:275380 6/27 (22%)
leucine-rich repeat 280..307 CDD:275380 10/27 (37%)
leucine-rich repeat 308..335 CDD:275380 6/27 (22%)
leucine-rich repeat 336..357 CDD:275380 6/40 (15%)
nlrc5XP_003200494.2 NACHT 199..374 CDD:283404
LRR_RI <706..887 CDD:238064 50/197 (25%)
LRR <707..>890 CDD:227223 51/200 (26%)
LRR_RI 885..>1143 CDD:238064 17/93 (18%)
leucine-rich repeat 987..1014 CDD:275381
leucine-rich repeat 1015..1035 CDD:275381
leucine-rich repeat 1070..1092 CDD:275381
LRR_RI 1086..>1289 CDD:238064
leucine-rich repeat 1093..1117 CDD:275381
leucine-rich repeat 1467..1489 CDD:275380
LRR_RI <1473..1729 CDD:238064
leucine-rich repeat 1490..1511 CDD:275380
leucine-rich repeat 1525..1547 CDD:275380
leucine-rich repeat 1553..1580 CDD:275380
leucine-rich repeat 1581..1608 CDD:275380
leucine-rich repeat 1609..1636 CDD:275380
leucine-rich repeat 1663..1690 CDD:275380
leucine-rich repeat 1691..1718 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.