DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8197 and kctd5b

Sequence 1:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_005174252.4 Gene:kctd5b ZFINID:ZDB-GENE-140106-245 Length:255 Species:Danio rerio

Alignment Length:72 Identity:18/73 (25%)
Similarity:32/73 (44%) Gaps:13/73 (18%)


  Fly   313 LNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDISYTYDEA 377
            |||...|...:|..|   .::..||:...|     :.|::|  :|:..:::   |.|...|:...
Zfish    87 LNYLRHGKLVLNKNL---TEEGALEEAEFY-----NITSLI--KLIKEKII---ERDAKSTHTPV 138

  Fly   378 LQDYRVV 384
            ...|||:
Zfish   139 KHVYRVL 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381
LRR_RI 137..374 CDD:238064 15/61 (25%)
leucine-rich repeat 162..189 CDD:275381
leucine-rich repeat 202..220 CDD:275380
leucine-rich repeat 223..251 CDD:275380
leucine-rich repeat 252..279 CDD:275380
leucine-rich repeat 280..307 CDD:275380
leucine-rich repeat 308..335 CDD:275380 6/22 (27%)
leucine-rich repeat 336..357 CDD:275380 5/21 (24%)
kctd5bXP_005174252.4 BTB_2 30..119 CDD:308049 10/40 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.