DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8197 and tcte1

Sequence 1:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_009293283.1 Gene:tcte1 ZFINID:ZDB-GENE-120406-12 Length:450 Species:Danio rerio

Alignment Length:432 Identity:86/433 (20%)
Similarity:154/433 (36%) Gaps:113/433 (26%)


  Fly    25 LFTILLLYCWQ---REYDKRPY---RQFQFKRLTFEERIGRRYHCIRDLRIIVNYLLRR--PQLS 81
            |..:|...|.|   :.::::|.   .|..||                      .|:|:|  ..|.
Zfish    38 LVPLLTTLCLQHIIKHFEEKPILHELQPSFK----------------------TYVLQRLPASLP 80

  Fly    82 VQISSLVVSN-----------WDAGLLKDFVRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVS 135
            :.|::.::|:           |....:..:..|    |    :.|.|.|....::.|.......:
Zfish    81 LTITANLISDESYWKRCCEARWGLADISTYDNS----W----KQMFFERHLQSIIELFIPDTTDT 137

  Fly   136 QLSLEGTPLTDEDVRILREFLLV--------------SKTLRRLNVSSCSLTQFNFALIADGVYK 186
            :..|:..||....|:.||...|:              |::...:.....|:..|:|.::.|   |
Zfish   138 KTVLDVLPLCQNYVKQLRVSQLLPPIKEPSRFDEDDGSESASDMGSDGPSMDHFDFRMLLD---K 199

  Fly   187 SPGVRRLSANRLL---GMSL---------------------------------SLDTEKISSVLS 215
            .|.::.||....:   ||:.                                 .:|.||...:::
Zfish   200 LPNLKELSVVYCVKGCGMNFEWNLFEFTFRDCESLAKALNSCKTLQVFRIHRSKVDDEKCCVIVN 264

  Fly   216 SLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGGNL 280
            .||...:|..|...|..::.:....||:.|.|  |:.:.|.:..|:|...||..|...::....|
Zfish   265 HLLDHPSLQELDFSHNHISDRGARAIAKLLNR--SQLKTLIVCNNQIRGAGAQALAHALAKNNTL 327

  Fly   281 ELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNH 345
            ..|:|....|...||:.:|:.|...:.|..|||..|:|...|...:..|:.:.|.|:.|.|..|.
Zfish   328 TSLNLRLNRIADEGGQALAQALIKNKTLVNLHLGGNNMTEPAAVALSQALVENCALKSLNLCNNR 392

  Fly   346 FDSRTAMIVRRLLDAEVVLHS----ELDISYTYDEALQDYRV 383
            ..:....::.     |.:.|:    |.||..|..:...:|.:
Zfish   393 LGADGGKVLE-----EGMTHNCTLVECDIRLTDVDQDSEYSI 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 8/41 (20%)
LRR_RI 137..374 CDD:238064 64/291 (22%)
leucine-rich repeat 162..189 CDD:275381 6/27 (22%)
leucine-rich repeat 202..220 CDD:275380 5/51 (10%)
leucine-rich repeat 223..251 CDD:275380 8/28 (29%)
leucine-rich repeat 252..279 CDD:275380 6/27 (22%)
leucine-rich repeat 280..307 CDD:275380 8/27 (30%)
leucine-rich repeat 308..335 CDD:275380 9/27 (33%)
leucine-rich repeat 336..357 CDD:275380 4/21 (19%)
tcte1XP_009293283.1 LRR_RI 142..441 CDD:238064 64/299 (21%)
leucine-rich repeat 272..298 CDD:275380 8/28 (29%)
leucine-rich repeat 299..322 CDD:275380 6/23 (26%)
leucine-rich repeat 327..354 CDD:275380 8/27 (30%)
leucine-rich repeat 355..382 CDD:275380 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24107
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.