DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8197 and tonsl

Sequence 1:NP_001286225.1 Gene:CG8197 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_002944768.3 Gene:tonsl XenbaseID:XB-GENE-5939806 Length:1427 Species:Xenopus tropicalis

Alignment Length:319 Identity:87/320 (27%)
Similarity:124/320 (39%) Gaps:77/320 (24%)


  Fly    89 VSNWDAGLLKD----------------FVRSL--------LPVWYIELRLMRFPREFFVMLRLNA 129
            |.:||...|.|                .||:|        |...::.||    ||:...:||...
 Frog  1060 VHSWDLPPLTDRYRKACQSLAVEENHLLVRALERQESSQCLTFSHLSLR----PRDLGPLLRALK 1120

  Fly   130 AKMNVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIA-----DGVYKSPG 189
            .:.::.||.|.|..|.|.:...|...|.....|..||:||..||......:|     |..:||..
 Frog  1121 LQNSLRQLHLSGNLLGDTEAAELLAVLSTMPNLTHLNLSSNRLTHEGIRKLANITQEDRPFKSLE 1185

  Fly   190 VRRLSANRLLGMSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTA----QDMIPIAEHLARTNS 250
            ...||.|. ||..||   :.::.:|.|..:.:|   |.|..|:|:|    |..|.:||       
 Frog  1186 HLDLSVNP-LGNGLS---QPLALLLRSCPVLST---LHLRGCQLSAKFLQQYRIQLAE------- 1236

  Fly   251 KFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLA--SCRRLQVLHL 313
            .||            ||.          :|:.|.||:..:|:.|.|.|.|.||  :..||.:..:
 Frog  1237 AFR------------GAV----------HLKTLSLSHNPLGSTGLELVLKTLAPETLTRLDIQAV 1279

  Fly   314 -NYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDIS 371
             :.|..|.....|:....:..|.|..|:|..||.....|:.:.|.|.....|.| ||:|
 Frog  1280 TSGNKEGLLIEPLVRYLSQDGCVLSHLSLACNHLTDGPALELARCLPVCPSLVS-LDLS 1337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 8/27 (30%)
LRR_RI 137..374 CDD:238064 71/248 (29%)
leucine-rich repeat 162..189 CDD:275381 11/32 (34%)
leucine-rich repeat 202..220 CDD:275380 4/18 (22%)
leucine-rich repeat 223..251 CDD:275380 9/32 (28%)
leucine-rich repeat 252..279 CDD:275380 4/27 (15%)
leucine-rich repeat 280..307 CDD:275380 11/29 (38%)
leucine-rich repeat 308..335 CDD:275380 5/28 (18%)
leucine-rich repeat 336..357 CDD:275380 7/21 (33%)
tonslXP_002944768.3 TPR_12 25..97 CDD:290160
TPR repeat 25..59 CDD:276809
TPR repeat 64..94 CDD:276809
TPR_12 65..141 CDD:290160
TPR repeat 106..154 CDD:276809
TPR repeat 160..194 CDD:276809
TPR repeat 199..229 CDD:276809
TPR repeat 240..265 CDD:276809
TPR_12 308..381 CDD:290160
TPR repeat 311..337 CDD:276809
TPR repeat 349..379 CDD:276809
TPR_11 350..422 CDD:290150
TPR repeat 384..422 CDD:276809
ANK 515..623 CDD:238125
ANK repeat 517..547 CDD:293786
Ank_2 521..616 CDD:289560
ANK repeat 549..580 CDD:293786
ANK repeat 585..616 CDD:293786
LRR_RI 1076..1339 CDD:238064 82/304 (27%)
LRR_8 1124..1194 CDD:290566 22/71 (31%)
leucine-rich repeat 1125..1152 CDD:275380 8/27 (30%)
leucine-rich repeat 1153..1183 CDD:275380 10/30 (33%)
leucine-rich repeat 1184..1211 CDD:275380 9/31 (29%)
leucine-rich repeat 1212..1243 CDD:275380 14/63 (22%)
leucine-rich repeat 1244..1270 CDD:275380 11/26 (42%)
leucine-rich repeat 1271..1298 CDD:275380 5/27 (19%)
leucine-rich repeat 1303..1330 CDD:275380 8/27 (30%)
leucine-rich repeat 1331..1350 CDD:275380 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.