DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and dkk1a

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001268729.2 Gene:dkk1a / 799377 ZFINID:ZDB-GENE-090313-406 Length:247 Species:Danio rerio


Alignment Length:190 Identity:45/190 - (23%)
Similarity:65/190 - (34%) Gaps:60/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LDEYLGPYGAVEQE-----------QHQP--HPPPQQMRQQTEVYGIVEPLIEDTP----C-ADR 110
            |..||..:|.:..:           :|.|  ..|...:.....|.|.|:   .|.|    | ||.
Zfish    11 LTVYLAVWGGITVDAQVGSVLRNSIRHLPAASSPSDAVSASPRVTGTVD---SDAPPSPHCSADS 72

  Fly   111 PCLLNDDCCPS-GVCVSTYGEGKCVYVFGRQRDLCQGHADCPQGSSCM-----LVPQEGAWRCEP 169
            .|.:.:.|..| |||:|      |    .::|..|.....|..|:.|:     |.........:.
Zfish    73 ECSIGEFCNGSRGVCLS------C----RKRRKRCARDGMCCAGNRCINGVCQLADAAAVGSADA 127

  Fly   170 SVESGGSTSLLEGI-------FGAKERQPL------------GSECSSSSDCQVINGMCC 210
            | ..||:|. :.|:       |....|..:            |..|..||||  :.|:||
Zfish   128 S-PPGGNTD-VSGVAVTRGQNFTHPRRTTVLSKPQQTQKGGEGETCLRSSDC--LEGLCC 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkk1aNP_001268729.2 Dickkopf_N 68..115 CDD:282549 16/56 (29%)
COLIPASE 167..236 CDD:305210 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.