| Sequence 1: | NP_610434.1 | Gene: | spab / 35901 | FlyBaseID: | FBgn0033358 | Length: | 245 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001104679.1 | Gene: | dkk2 / 792404 | ZFINID: | ZDB-GENE-080204-14 | Length: | 243 | Species: | Danio rerio |
| Alignment Length: | 245 | Identity: | 47/245 - (19%) |
|---|---|---|---|
| Similarity: | 73/245 - (29%) | Gaps: | 94/245 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 20 LDPSLAASASSFASGNAWQRALFGRESRNLMHRRAPFSGAADLGLDEYLGPYGAVEQEQHQP-HP 83
Fly 84 PPQQMRQQTEVYGIVEPLIEDTPCADRP--CLLNDDCCPSGVCVSTY------------------ 128
Fly 129 -------------GEGKC---VYVFGRQRDLCQGHADCPQGSSCMLVPQEGAWR--CEPSVESGG 175
Fly 176 STSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQ---------QQRLH 216 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| spab | NP_610434.1 | None | |||
| dkk2 | NP_001104679.1 | Dickkopf_N | 70..120 | CDD:282549 | 15/77 (19%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1139517at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||