DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and Dkk3

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001347186.1 Gene:Dkk3 / 50781 MGIID:1354952 Length:366 Species:Mus musculus


Alignment Length:104 Identity:26/104 - (25%)
Similarity:40/104 - (38%) Gaps:27/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CLLNDDCCPSGVCVSTYGEGKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAW-RCEPSVESGG 175
            |::::||.|:..|..:..:..|.....:|. ||...::|.....|       || .|......||
Mouse   164 CIIDEDCGPTRYCQFSSFKYTCQPCRDQQM-LCTRDSECCGDQLC-------AWGHCTQKATKGG 220

  Fly   176 STSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQQQR 214
            :                |:.|.:..|||  .|:||..||
Mouse   221 N----------------GTICDNQRDCQ--PGLCCAFQR 241



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.