| Sequence 1: | NP_610434.1 | Gene: | spab / 35901 | FlyBaseID: | FBgn0033358 | Length: | 245 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_055236.1 | Gene: | DKK2 / 27123 | HGNCID: | 2892 | Length: | 259 | Species: | Homo sapiens |
| Alignment Length: | 259 | Identity: | 52/259 - (20%) |
|---|---|---|---|
| Similarity: | 75/259 - (28%) | Gaps: | 109/259 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 PSLAASASSFASGNAWQRALFG--RESRNLMHRRAPFSGAADLGLDEYLGPYGAVEQEQHQPHPP 84
Fly 85 PQQMRQQTEVYGIVEPLIEDTPC-----ADRPCLLNDDCCPSGVCVSTYGEGKCVYVF------- 137
Fly 138 ------GRQRDLCQGHADCPQGSSCMLVPQEGAWRCEPSVESGGSTSLLEGIFGAKERQPLGSEC 196
Fly 197 SSSSDCQVINGMCC---------------------QQQRLHHRAAI--------KLSCGYFRDA 231 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| spab | NP_610434.1 | None | |||
| DKK2 | NP_055236.1 | Dickkopf_N | 78..128 | CDD:282549 | 13/82 (16%) |
| DKK-type Cys-1 | 78..127 | 13/81 (16%) | |||
| DKK-type Cys-2 | 183..256 | 17/65 (26%) | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1139517at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||