powered by:
Protein Alignment spab and DKK3
DIOPT Version :9
| Sequence 1: | NP_610434.1 |
Gene: | spab / 35901 |
FlyBaseID: | FBgn0033358 |
Length: | 245 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001317149.1 |
Gene: | DKK3 / 27122 |
HGNCID: | 2893 |
Length: | 364 |
Species: | Homo sapiens |
| Alignment Length: | 104 |
Identity: | 27/104 - (25%) |
| Similarity: | 39/104 - (37%) |
Gaps: | 27/104 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 112 CLLNDDCCPSGVCVSTYGEGKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAW-RCEPSVESGG 175
|::::||.||..|.....:..|....| ||.||...::|.....|: | .|......|.
Human 147 CIIDEDCGPSMYCQFASFQYTCQPCRG-QRMLCTRDSECCGDQLCV-------WGHCTKMATRGS 203
Fly 176 STSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQQQR 214
: |:.|.:..||| .|:||..||
Human 204 N----------------GTICDNQRDCQ--PGLCCAFQR 224
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1139517at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.