DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and DKK4

DIOPT Version :10

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_055235.1 Gene:DKK4 / 27121 HGNCID:2894 Length:224 Species:Homo sapiens


Alignment Length:179 Identity:41/179 - (22%)
Similarity:62/179 - (34%) Gaps:58/179 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGLDEYLGPYGAVEQEQHQPHPPPQQMRQQTEVYGIVE--PLIEDTPCADRP-CLLNDD------ 117
            |||.....|.||:..:.:       .:|...:::|..:  ..:.||.|..|. ||...|      
Human     7 LGLSWLCSPLGALVLDFN-------NIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCA 64

  Fly   118 --------------CCPSGVCVSTYGEGKCVY------VFGRQRDLCQG-HADCPQGSSCMLVPQ 161
                          |||..:||:..    |..      :..||.|...| ||:...|...    |
Human    65 TCRGLRRRCQRDAMCCPGTLCVNDV----CTTMEDATPILERQLDEQDGTHAEGTTGHPV----Q 121

  Fly   162 EGAWRCEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQVINGMCC 210
            |...:.:||::...         |.|.::  |..|..:.||.  .|:||
Human   122 ENQPKRKPSIKKSQ---------GRKGQE--GESCLRTFDCG--PGLCC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
DKK4NP_055235.1 Dkk4_Cys1 37..91 CDD:438007 12/57 (21%)
DKK-type Cys-1 41..90 12/52 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..139 9/42 (21%)
Dkk4_Cys2 128..221 CDD:438001 11/43 (26%)
DKK-type Cys-2 145..218 6/15 (40%)

Return to query results.
Submit another query.