DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and Dkk4

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_663567.1 Gene:Dkk4 / 234130 MGIID:2385299 Length:221 Species:Mus musculus


Alignment Length:174 Identity:37/174 - (21%)
Similarity:58/174 - (33%) Gaps:48/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGLDEYLGPYGAVEQEQHQPHPPPQQMRQQTEVYGIVEPLIEDTPCADRPCLLNDDCCPSGVCVS 126
            |||..:..|..|:..:.:       .::...:|.|..:..:         |..:.||.....|::
Mouse     7 LGLSWFCSPLAALVLDFN-------NIKSSADVQGAGKGSL---------CASDRDCSEGKFCLA 55

  Fly   127 TYGEGKCVYVFGRQRDLCQGHADCPQGSSCM-----------------LVPQEGA-------WRC 167
            .:.|........|.|..||..|.|..|:.|:                 ...|:||       |..
Mouse    56 FHDERSFCATCRRVRRRCQRSAVCCPGTVCVNDVCTAVEDTRPVMDRNTDGQDGAYAEGTTKWPA 120

  Fly   168 EPSVESG-GSTSLLEGIFGAKERQPLGSECSSSSDCQVINGMCC 210
            |.:...| .||...:...|.:     |..|..:|||.  .|:||
Mouse   121 EENRPQGKPSTKKSQSSKGQE-----GESCLRTSDCG--PGLCC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
Dkk4NP_663567.1 Dickkopf_N 41..91 CDD:368068 13/49 (27%)
DKK-type Cys-1 41..90 13/48 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 9/46 (20%)
DKK-type Cys-2 145..218 7/15 (47%)
Prokineticin <145..202 CDD:148298 7/15 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.