DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and DKK1

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_036374.1 Gene:DKK1 / 22943 HGNCID:2891 Length:266 Species:Homo sapiens


Alignment Length:270 Identity:54/270 - (20%)
Similarity:86/270 - (31%) Gaps:102/270 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLGLAHQLDPSLAASASSFASGNAWQRALFGRESRNL---MHRRAPFSGAADLGLDEYLGPYGAV 74
            |||        ::|:.:|..:.||         .:||   :...|...|:|.......|.|.|..
Human    26 LLG--------VSATLNSVLNSNA---------IKNLPPPLGGAAGHPGSAVSAAPGILYPGGNK 73

  Fly    75 EQ--EQHQPHPPPQQMRQQTEVYGIVEPLIEDTPCAD-------------------RPCLLNDDC 118
            .|  :.:||:|..:.....|:.|           ||.                   :.|:.:..|
Human    74 YQTIDNYQPYPCAEDEECGTDEY-----------CASPTRGGDAGVQICLACRKRRKRCMRHAMC 127

  Fly   119 CP-----SGVCVS----------------TYG---------------EGKCVYVFGRQRDLCQGH 147
            ||     :|:|||                ::|               ..|..:..|::..:|...
Human   128 CPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRS 192

  Fly   148 ADCPQGSSCMLVPQEGAWR--CEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQVINGMCC 210
            :||..|..|    ....|.  |:|        .|.||....|.|:...........|....|:.|
Human   193 SDCASGLCC----ARHFWSKICKP--------VLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSC 245

  Fly   211 QQQRLHHRAA 220
            :.|:.||:|:
Human   246 RIQKDHHQAS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
DKK1NP_036374.1 Dickkopf_N 85..139 CDD:309719 9/64 (14%)
DKK-type Cys-1 85..138 9/63 (14%)
DKK-type Cys-2 189..263 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.