Sequence 1: | NP_610434.1 | Gene: | spab / 35901 | FlyBaseID: | FBgn0033358 | Length: | 245 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036374.1 | Gene: | DKK1 / 22943 | HGNCID: | 2891 | Length: | 266 | Species: | Homo sapiens |
Alignment Length: | 270 | Identity: | 54/270 - (20%) |
---|---|---|---|
Similarity: | 86/270 - (31%) | Gaps: | 102/270 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 LLGLAHQLDPSLAASASSFASGNAWQRALFGRESRNL---MHRRAPFSGAADLGLDEYLGPYGAV 74
Fly 75 EQ--EQHQPHPPPQQMRQQTEVYGIVEPLIEDTPCAD-------------------RPCLLNDDC 118
Fly 119 CP-----SGVCVS----------------TYG---------------EGKCVYVFGRQRDLCQGH 147
Fly 148 ADCPQGSSCMLVPQEGAWR--CEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQVINGMCC 210
Fly 211 QQQRLHHRAA 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
spab | NP_610434.1 | None | |||
DKK1 | NP_036374.1 | Dickkopf_N | 85..139 | CDD:309719 | 9/64 (14%) |
DKK-type Cys-1 | 85..138 | 9/63 (14%) | |||
DKK-type Cys-2 | 189..263 | 20/79 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1139517at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |