powered by:
                  
 
    
 
    
             
          
            Protein Alignment spab and Dkk3
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_610434.1 | 
            Gene: | spab / 35901 | 
            FlyBaseID: | FBgn0033358 | 
            Length: | 245 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_612528.2 | 
            Gene: | Dkk3 / 171548 | 
            RGDID: | 621846 | 
            Length: | 348 | 
            Species: | Rattus norvegicus | 
          
        
        
        
          
            | Alignment Length: | 104 | 
            Identity: | 25/104 - (24%) | 
          
          
            | Similarity: | 39/104 -  (37%) | 
            Gaps: | 27/104 - (25%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly   112 CLLNDDCCPSGVCVSTYGEGKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAW-RCEPSVESGG 175 
            |::::||.|:..|..:..:..|.....:|. ||...::|.....|       || .|......|. 
  Rat   147 CIIDEDCGPTRYCQFSSFKYTCQPCRDQQM-LCTRDSECCGDQLC-------AWGHCTQKATKGS 203 
 
  Fly   176 STSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQQQR 214 
            :                |:.|.:..|||  .|:||..|| 
  Rat   204 N----------------GTICDNQRDCQ--PGLCCAFQR 224 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            1 | 
            1.010 | 
            - | 
            - | 
             | 
            D1139517at2759 | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 1.010 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.