DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spab and Dkk3

Sequence 1:NP_610434.1 Gene:spab FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_612528.2 Gene:Dkk3 RGDID:621846 Length:348 Species:Rattus norvegicus

Alignment Length:104 Identity:25/105 (24%)
Similarity:39/105 (37%) Gaps:27/105 (26%)


  Fly   112 CLLNDDCCPSGVCVSTYGEGKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAW-RCEPSVESGG 175
            |::::||.|:..|..:..:..|.....:|. ||...::|.....|       || .|......|.
  Rat   147 CIIDEDCGPTRYCQFSSFKYTCQPCRDQQM-LCTRDSECCGDQLC-------AWGHCTQKATKGS 203

  Fly   176 STSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQQQR 214
            :                |:.|.:..|||  .|:||..||
  Rat   204 N----------------GTICDNQRDCQ--PGLCCAFQR 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
Dkk3NP_612528.2 Dickkopf_N 147..196 CDD:282549 14/57 (25%)
Prokineticin <208..273 CDD:148298 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.