DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and Dkk1

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:252 Identity:58/252 - (23%)
Similarity:82/252 - (32%) Gaps:102/252 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RWAAMLLLLGLAHQLDPSLAASA---SSFASGNAWQRALFGRESRNLMHRRAPFSGAADLGLDEY 67
            |:.|:..::.|...  |.|.|||   |...:.||         .:||   ..|..||..      
Mouse    11 RFLAVFTMMALCSL--PLLGASATLNSVLINSNA---------IKNL---PPPLGGAGG------ 55

  Fly    68 LGPYGAVE---------------QEQHQPHPPPQQMRQQTEVYGIVEPLIEDTPCADRPCLLNDD 117
             .|..||.               .:.:||:                 |..||..|.      :|:
Mouse    56 -QPGSAVSVAPGVLYEGGNKYQTLDNYQPY-----------------PCAEDEECG------SDE 96

  Fly   118 CC--PSGVCVSTYGEGKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAWRCEPS---------- 170
            .|  ||.......|...|: ...::|..|..||.|..|:.|    :.|.  |.||          
Mouse    97 YCSSPSRGAAGVGGVQICL-ACRKRRKRCMRHAMCCPGNYC----KNGI--CMPSDHSHFPRGEI 154

  Fly   171 ----VESGGS-------------TSLLEGIFGAKERQPLGSECSSSSDCQVINGMCC 210
                :|:.|:             |:|...|:..|.::  ||.|..||||..  |:||
Mouse   155 EESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQE--GSVCLRSSDCAA--GLCC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 17/68 (25%)
DKK-type Cys-1 86..141 17/67 (25%)
DKK-type Cys-2 195..269 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.