DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spab and LOC101735124

Sequence 1:NP_610434.1 Gene:spab FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_004920543.1 Gene:LOC101735124 ID: Length:292 Species:Xenopus tropicalis

Alignment Length:73 Identity:18/74 (24%)
Similarity:27/74 (36%) Gaps:23/74 (31%)


  Fly   140 QRDLCQGHADCPQGSSCMLVPQEGAWRCEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQV 204
            ||:.||..::|..|..|:      :..|...|...|:                |:||..|:| |.
 Frog    66 QREGCQADSECHLGMRCI------SGNCTEGVNVTGT----------------GAECDPSND-QC 107

  Fly   205 INGMCCQQ 212
            ....||.:
 Frog   108 APEFCCSK 115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
LOC101735124XP_004920543.1 DUF1471 2..>52 CDD:299754
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.