powered by:
Protein Alignment: spab and LOC100495217
Sequence 1: | NP_610434.1 |
Gene: | spab |
FlyBaseID: | FBgn0033358 |
Length: | 245 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004916351.1 |
Gene: | LOC100495217 |
ID: | |
Length: | 292 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 18/74 (24%) |
Similarity: | 27/74 (36%) |
Gaps: | 23/74 (31%) |
Fly 140 QRDLCQGHADCPQGSSCMLVPQEGAWRCEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQV 204
||:.||..::|..|..|: :..|...|...|: |:||..|:| |.
Frog 66 QREGCQADSECHLGMRCI------SGNCTEGVNVTGT----------------GAECDPSND-QC 107
Fly 205 INGMCCQQ 212
....||.:
Frog 108 APEFCCSK 115
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
spab | NP_610434.1 |
None |
LOC100495217 | XP_004916351.1 |
DUF1471 |
2..>52 |
CDD:299754 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
|
|
|
D1139517at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.