DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spab and dkk2

Sequence 1:NP_610434.1 Gene:spab FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002940336.1 Gene:dkk2 XenbaseID:XB-GENE-480441 Length:255 Species:Xenopus tropicalis

Alignment Length:191 Identity:36/192 (19%)
Similarity:54/192 (28%) Gaps:82/192 (43%)


  Fly    96 GIVEPLIEDTPC-----------ADRPCLL----------NDDCCP-----SGVCV--------- 125
            |...|.|.|..|           |...|:|          :..|||     :|:|:         
 Frog    72 GQAYPCISDKECEVGRYCYSPHQAPSSCMLCRRKKKRCHRDGMCCPGNRCNNGICIPVAETIMSP 136

  Fly   126 ----------------------STYGE--GKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAWR 166
                                  ...|:  .|...:.|.:.|.|....||.:|..|    ....|.
 Frog   137 HIPALETRPKKNGHISNKDLGWQNLGKHHSKIPLIKGHEGDPCLRSTDCIEGHCC----ARHFWT 197

  Fly   167 --CEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQ---------QQRLH 216
              |:|.:..|...:.|      :::...|.|.....||  ..|:.|:         :.|||
 Frog   198 KICKPVLHQGEVCTKL------RKKGSHGLEIFQRCDC--AKGLSCKVWKDATYSSKSRLH 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkk2XP_002940336.1 Dickkopf_N 77..127 CDD:282549 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.