DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and dkk2

DIOPT Version :9

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002940336.1 Gene:dkk2 / 100493182 XenbaseID:XB-GENE-480441 Length:255 Species:Xenopus tropicalis


Alignment Length:191 Identity:36/191 - (18%)
Similarity:54/191 - (28%) Gaps:82/191 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GIVEPLIEDTPC-----------ADRPCLL----------NDDCCP-----SGVCV--------- 125
            |...|.|.|..|           |...|:|          :..|||     :|:|:         
 Frog    72 GQAYPCISDKECEVGRYCYSPHQAPSSCMLCRRKKKRCHRDGMCCPGNRCNNGICIPVAETIMSP 136

  Fly   126 ----------------------STYGE--GKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAWR 166
                                  ...|:  .|...:.|.:.|.|....||.:|..|    ....|.
 Frog   137 HIPALETRPKKNGHISNKDLGWQNLGKHHSKIPLIKGHEGDPCLRSTDCIEGHCC----ARHFWT 197

  Fly   167 --CEPSVESGGSTSLLEGIFGAKERQPLGSECSSSSDCQVINGMCCQ---------QQRLH 216
              |:|.:..|...:.|      :::...|.|.....||  ..|:.|:         :.|||
 Frog   198 KICKPVLHQGEVCTKL------RKKGSHGLEIFQRCDC--AKGLSCKVWKDATYSSKSRLH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkk2XP_002940336.1 Dkk2_Cys1 73..127 CDD:438009 11/53 (21%)
Dkk2_Cys2 171..254 CDD:437999 21/92 (23%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.