DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: spab and dkkx

Sequence 1:NP_610434.1 Gene:spab FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002940985.2 Gene:dkkx XenbaseID:XB-GENE-1219019 Length:187 Species:Xenopus tropicalis

Alignment Length:108 Identity:26/109 (24%)
Similarity:36/109 (33%) Gaps:40/109 (37%)


  Fly   122 GVCVSTYGEGKCVYVFGRQRDLCQGHADCPQGSSCMLVPQEGAWRCEPSVESGGSTSLLEGIFGA 186
            |:||:...||:          .|:..:.|.:|..||.      .||:..:..|..          
 Frog    67 GLCVALRHEGQ----------YCRKDSQCVRGLGCMY------GRCQRMIPGGHE---------- 105

  Fly   187 KERQPLGSECSSSSDCQVINGMCCQQQRLHHRAAI---KLSCG 226
                  |:.|....||.  ..|||.:   ||...|   ||..|
 Frog   106 ------GARCRQDKDCS--PNMCCAR---HHGEMICKRKLPLG 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkkxXP_002940985.2 Dickkopf_N 50..97 CDD:282549 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.