DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spab and dkk3b

DIOPT Version :8

Sequence 1:NP_610434.1 Gene:spab / 35901 FlyBaseID:FBgn0033358 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001083014.1 Gene:dkk3b / 100038765 ZFINID:ZDB-GENE-061207-74 Length:283 Species:Danio rerio

Alignment Length:158 Identity:33/158 - (20%)
Similarity:51/158 - (32%) Gaps:63/158 - (39%)


  Fly   101 LIEDTPC---ADRPCLLNDDCCPSGVC----------------------VSTYGEGKCVY----- 135
            ||::|..   .|..|::::||.....|                      |...|:..||:     
Zfish   123 LIQNTERWNEVDHECMIDEDCGDGSFCLYEIVTSKCVPCQTTNMECTKDVECCGDQLCVWGVCAQ 187

  Fly   136 --VFGRQRDLCQGHADCPQGSSC-----MLVPQEGAWRCEPSVESG-----GSTSLLEGIF---- 184
              ..|:...:||...||.....|     :|.|.     |.|..:.|     ....|:|.:.    
Zfish   188 NKTKGQSGTICQNQNDCSPQHCCAFHKALLFPV-----CRPKPQEGQGCEREGNQLMEVLLWEDE 247

  Fly   185 GAKERQPLGSECSSSSDCQVINGMCCQQ 212
            |.:|..|    |::        |:.|||
Zfish   248 GPREHCP----CAA--------GLLCQQ 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
spabNP_610434.1 None
dkk3bNP_001083014.1 Dickkopf_N 137..186 CDD:282549 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1139517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.