DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8230 and AT1G04200

Sequence 1:NP_610431.1 Gene:CG8230 FlyBaseID:FBgn0027607 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_171916.2 Gene:AT1G04200 AraportID:AT1G04200 Length:732 Species:Arabidopsis thaliana

Alignment Length:745 Identity:221/746 (30%)
Similarity:359/746 (48%) Gaps:151/746 (20%)


  Fly    20 FVGRQH--IAHDDEAFWNGLLNYNIVLPENSQDQLNLDSRLEALCQSFIGNNLKTGNFGSLVTVF 82
            |||.:.  :|.|   |||.||.    ||.:|:..   ..|::..|:.|..:|..|.:...|:...
plant    26 FVGEKSFPLASD---FWNKLLE----LPLSSRWP---SDRVQQACELFAQSNGYTRHLAKLLIHL 80

  Fly    83 LEKTSELLSLSDQESNMHVWQTFNALFIIRSLVKYINETGSEFQLLQHFEAMPNAELLQAALEQQ 147
            .....|||..||.:|:::. :..||.:|....:||:.|.|....|.:          |..:|::.
plant    81 SWCLQELLQASDDQSSLYK-KAVNATYISSVFLKYLIENGKSDSLQE----------LHLSLDES 134

  Fly   148 QQTPAESATIAMEATEQSAAAAVPVIVDGSKFETFI-DALVNLIVVIPVKEFTYHLHLEAVNMLI 211
            :..|..                   .|.....:.|: .::::.|....|...:|.||.|.:|.::
plant   135 EPVPHG-------------------FVMDQDIQNFVMHSVLSFIGSNEVSPNSYVLHQELLNFML 180

  Fly   212 TLLSVHLF---AQQPTD------------KSIVFRTVFKCQHANVLMSALLHFVARIVEVPHTMF 261
            ..:|..|.   :..|||            ||:|         :.|:...||::::|....|    
plant   181 VTMSTQLLSGPSHGPTDANPFIDAAMTQEKSLV---------SLVVRRLLLNYISRHRTPP---- 232

  Fly   262 GSSSAGSFVFGIAESLLSIFTFRKQPDILKAGQAA--------------GGGELSQRFRTHYPLA 312
               :|.|:::...:|         |..:.:.|.||              .||..:       |||
plant   233 ---NAKSYMYSDGDS---------QGILERVGSAAASLVLLPLNYLVSNSGGSKN-------PLA 278

  Fly   313 NQSLLLILILTN---------------------------HCTAQDNAYRTSL-------FSCADS 343
            ..||.::|||.|                           |..:.||.:..:|       |..:|.
plant   279 ECSLHVLLILINYHKSIMSDESMTDKSDDSATSESVSKVHVFSSDNTFSKALANARDVEFDRSDV 343

  Fly   344 KDSPKQGAVSFQIDFSAVYETLCTIVTIDQATLLLYLLLHRNERFYRFVMQQQDLEQLVIPILQT 408
            :.:........:|.|:::::||...:..:.|.||||.||..|..|..:|:.:.||:.|::|||:|
plant   344 EGNAHPAGPHVRIPFASLFDTLGMFLADEGAVLLLYSLLQGNSDFKEYVLVRTDLDTLLMPILET 408

  Fly   409 LYNAPD-SNSHHIYMSLIVLLILSEDEGFNKNVHTIMLKNITWYTERTISEISLGGILILIVIRT 472
            ||||.. ::|:.|||.||||||||:|..||.::|.::|.::.||.|..:.:.|||.::::|:|||
plant   409 LYNASKRTSSNQIYMMLIVLLILSQDSSFNSSIHKMILPSVPWYKEHLLHQTSLGSLMVIILIRT 473

  Fly   473 IQYNMLKMRDKYLHTNCLAALANMSGHFRALHPYVAQRLVSLFETLARKHTRLDAQLKEPADSAV 537
            :|:|:.|:||.||.|.|||.||||:.|...|..|.:|||||||..|:||:.:| :.|......::
plant   474 VQHNLSKLRDVYLQTTCLATLANMAPHAHHLSAYASQRLVSLFYMLSRKYNKL-SDLTGDKLQSI 537

  Fly   538 FVNVS----TTPEDMLQDLSVLEEVLRMVLEILNSCLTNQLVYCPNLVYTLLYKRSVFEGFRSHH 598
            .:|:|    ...||:..:|.:..:.||:||:|||:.||..|...|.:||.:::::.||:.|::|.
plant   538 KINLSGEDVGVSEDLAAELQIFTDFLRLVLDILNAILTYALPRNPEIVYAIMHRQEVFQPFKNHP 602

  Fly   599 AFQDVIQNIDMVVGFFSSRLQRVQEQRGELGVNEVLEVISKGASQWSSDRLRKFPDLKFKYVEED 663
            .|.::::||..|:.||:||:...:..| |..|.:||:.|......|..:.::.|..|.|.|.:|.
plant   603 RFHELVENIYTVLDFFNSRMDSQRSDR-EWSVQKVLQFIINNCRSWRGEGMKMFTQLHFSYEQES 666

  Fly   664 APEEFFIPYVWTLV---CKYGCVHFSSESI 690
            .||||||||||.|.   |.:|   |:.::|
plant   667 HPEEFFIPYVWQLAFSRCGFG---FNPDAI 693

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8230NP_610431.1 Dymeclin 1..676 CDD:286785 216/727 (30%)
AT1G04200NP_171916.2 Dymeclin 1..679 CDD:286785 216/727 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H69237
Inparanoid 1 1.050 284 1.000 Inparanoid score I838
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D982213at2759
OrthoInspector 1 1.000 T193551
orthoMCL 1 0.900 OOG5_132417
Panther 1 1.100 LDO PTHR12895
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.