DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8230 and Dym

Sequence 1:NP_610431.1 Gene:CG8230 FlyBaseID:FBgn0027607 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_082003.1 Gene:Dym MGIID:1918480 Length:669 Species:Mus musculus

Alignment Length:700 Identity:302/700 (43%)
Similarity:435/700 (62%) Gaps:76/700 (11%)


  Fly     1 MGINVSRTADLGSNQWLQRFVGRQHIAHDDEAFWNGLLNYNIVLPENSQDQLNLDSRLEALCQSF 65
            ||.|.|:.:||..|::|::..|.:.|:.:| .|||.|.:::...|.:|.:...|:....::|:|.
Mouse     1 MGSNSSKISDLPKNEYLKKLSGPESISEND-PFWNQLFSFSFPAPTSSSELKLLEEATISVCKSL 64

  Fly    66 IGNNLKTGNFGSLVTVFLEKTSELLSLSDQESNMHVWQTFNALFIIRSLVKYINETGSEFQLLQH 130
            :.||.:|||..:|..|||.:|.||...::.::::.:|||.||||||..|:|......||.:|..|
Mouse    65 VENNPRTGNLAALTKVFLSRTRELRLSAECQNHIFIWQTHNALFIICCLLKVFIRELSEEELQLH 129

  Fly   131 FEAMPNAELLQAALEQQQQTPAESATIAMEATEQSAAAAVPVIVDGSKFETFIDALVNLIVVIPV 195
            |             ..::::|...::.:.:..|:                 .:.:||.||...|:
Mouse   130 F-------------TYEEKSPGSYSSDSEDLLEE-----------------LLCSLVQLITDTPL 164

  Fly   196 KEFTYHLHLEAVNMLITLLSVHLFAQQPTDKSIVFRTVFK--C-QHANVLMSALLHFVARIVEVP 257
            .:.||.:.:||::.::..||..||.::...:||..:.:.:  | .:.:.|:..||:...|..:.|
Mouse   165 LDITYEIAVEAISAMVVFLSCQLFHKEVLRQSISHKYLMQGPCLPYTSKLVKTLLYNFIRQEKPP 229

  Fly   258 ----HTMFGSSSAGSFVF----GIAESLLSIFTFRKQPDILKAG-QAAGGGELSQRFRTHYPLAN 313
                |.....|..|..::    |:|..|.::||      :..|| :||...||:.      ||||
Mouse   230 PPGTHVFPQQSDGGGLLYGLASGVATGLWTVFT------LGGAGSKAAASPELTS------PLAN 282

  Fly   314 QSLLLILILTNHCTAQD--NAYRTSLFSCADSKDS---PKQGAVSFQIDFSAVYETLCTIVTIDQ 373
            |||||:|:|.|...|.|  |.||.::.|..:::||   |.....:|||:|:::|..||...|.||
Mouse   283 QSLLLLLVLVNLTDAPDIPNPYRQAVSSFKNTQDSSPFPSSIPHTFQINFNSLYTALCEQQTSDQ 347

  Fly   374 ATLLLYLLLHRNERFYRFVMQQQDLEQLVIPILQTLYNAPDSNSHHIYMSLIVLLILSEDEGFNK 438
            ||||||.|||:|.....:|:.:.|:|.||:|||:.||:..:.||||:||:||:||||:||:|||:
Mouse   348 ATLLLYTLLHQNSNVRTYVLARTDMENLVLPILEILYHVEERNSHHVYMALIILLILTEDDGFNR 412

  Fly   439 NVHTIMLKNITWYTERTISEISLGGILILIVIRTIQYNMLKMRDKYLHTNCLAALANMSGHFRAL 503
            ::|.::|:|||||:||.::|||||.:|||:|||||||||.:.|||||||||||||||||..||:|
Mouse   413 SIHEVILRNITWYSERVLTEISLGSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMSAQFRSL 477

  Fly   504 HPYVAQRLVSLFETLARKHTRLDAQ----LKEPADSAVFVNVSTTP-EDMLQDLSVLEEVLRMVL 563
            |.|.|||::|||..|::||.::..|    |:.|..|      |..| .|..|||||:|||:||:|
Mouse   478 HQYAAQRIISLFSLLSKKHNKVLEQATQSLRGPLSS------SDVPLPDYAQDLSVIEEVIRMML 536

  Fly   564 EILNSCLTNQLVYCPNLVYTLLYKRSVFEGFRSHHAFQDVIQNIDMVVGFFSSRLQRVQEQRG-E 627
            ||:||||||.|.:.|||||.|||||.:||.||:|.:|||::||||:|:.||||||.    |.| |
Mouse   537 EIINSCLTNSLHHNPNLVYALLYKRDLFEQFRTHPSFQDIMQNIDLVISFFSSRLL----QAGAE 597

  Fly   628 LGVNEVLEVISKGASQWSSDRLRKFPDLKFKYVEEDAPEEFFIPYVWTLV 677
            |.|..|||:|.:|......|||:|||:||||||||:.||||||||||:||
Mouse   598 LSVERVLEIIKQGVVALPKDRLKKFPELKFKYVEEEQPEEFFIPYVWSLV 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8230NP_610431.1 Dymeclin 1..676 CDD:286785 300/698 (43%)
DymNP_082003.1 Dymeclin 1..646 CDD:286785 300/698 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201362066
eggNOG 1 0.900 E1_KOG2225
Hieranoid 1 1.000
Homologene 1 1.000 H69237
Inparanoid 1 1.050 515 1.000 Inparanoid score I1280
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005679
OrthoInspector 1 1.000 T1083175
orthoMCL 1 0.900 OOG5_132417
Panther 1 1.100 LDO PTHR12895
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3721
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.