DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8230 and Dym

Sequence 1:NP_610431.1 Gene:CG8230 FlyBaseID:FBgn0027607 Length:699 Species:Drosophila melanogaster
Sequence 2:XP_017456366.1 Gene:Dym RGDID:1309111 Length:729 Species:Rattus norvegicus

Alignment Length:756 Identity:302/757 (40%)
Similarity:430/757 (57%) Gaps:128/757 (17%)


  Fly     1 MGINVSRTADLGSNQWLQRFVGRQHIAHDDEAFWNGLLNYNIVLPENSQDQLNLDSRLEALCQSF 65
            ||.|.|:.:||..|::|:|..|.:.|:.:| .|||.|.:::...|.:|.:...|:....::|:|.
  Rat     1 MGSNSSKISDLPKNEYLKRLSGPEAISEND-PFWNQLFSFSFSAPTSSTELKLLEEATISVCKSL 64

  Fly    66 IGNNLKTGNFGSLVTVFLEKTSELLSLSDQESNMHVWQTFNALFIIRSLVKYINETGSEFQLLQH 130
            :.||.:|||..:|..|||.:|.||...::.::::.:|||.||||||..|:|......||.:|..|
  Rat    65 VENNPRTGNLAALTKVFLARTRELRLSAECQNHIFIWQTHNALFIICCLLKVFICEMSEEELQLH 129

  Fly   131 F---EAMPNAELLQAALEQQQQTPAESATIAMEATEQSAAAAVPVIVDGSKFETFID----ALVN 188
            |   |.:|....|...|                               ||..|..::    :|:.
  Rat   130 FTYEEKLPGTYTLCVLL-------------------------------GSDSEDLLEELLCSLIQ 163

  Fly   189 LIVVIPVKEFTYHLHLEAVNMLITLLSVHLFAQQPTDKSIVFRTVFK--C-QHANVLMSALLHFV 250
            ||...|:.:.||.:.:||::.:|..||..||.::...:||..:.:.:  | .:.:.|:..||:..
  Rat   164 LITDTPLLDITYEISVEAISAMIVFLSCQLFHKEVLRQSISHKYLMQGPCLPYTSKLVKTLLYNF 228

  Fly   251 ARIVEVP----HTMFGSSSAGSFVF----GIAESLLSIFTFRKQPDILKAGQAAGGGELSQRFRT 307
            .|..:.|    |.....|..|..::    |:|..|.::||      :...|..|...||:.    
  Rat   229 IRQEKPPPPGTHVFPQQSDGGGLLYGLASGVATGLWTVFT------LGGVGSKAASPELTS---- 283

  Fly   308 HYPLANQSLLLILILTNHCTAQD--NAYRTSLFSCADSKDS---PKQGAVSFQIDFSAVYETLCT 367
              |||||||||:|:|.|...|.|  |.||.::.|..:::||   |.....:|||:|:::|.|||.
  Rat   284 --PLANQSLLLLLVLVNLTDAPDIPNPYRQAVTSFKNTQDSSPFPSSVPHTFQINFNSLYTTLCE 346

  Fly   368 IVTIDQATLLLYLLLHRNERFYRFVMQQQDLEQLVIPILQTLYNAPDSNSHHIYMSLIVLLILSE 432
            ..|.||||||||.|||:|.....:::.:.|:|.||:|||:.||:..:.||||:||:||:||||:|
  Rat   347 QQTSDQATLLLYTLLHQNANVRTYMLARTDMENLVLPILEILYHVEERNSHHVYMALIILLILTE 411

  Fly   433 DEGFNKNVHTIMLKNITWYTERTISEISLGGILILIVIRTIQYNMLKMRDKYLHTNCLAALANMS 497
            |:|||:::|.::|||||||:||.::|||||.:|||:|||||||||.:.|||||||||||||||||
  Rat   412 DDGFNRSIHEVILKNITWYSERVLTEISLGSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMS 476

  Fly   498 GHFRALHPYVAQRLV-------------------------------------------------- 512
            ..||:||.|.|||::                                                  
  Rat   477 AQFRSLHQYAAQRIISYTCRHLRRCVYLSDRLYSPRSPRSARQRCLSAPSDSGEELLSLTCSHIL 541

  Fly   513 -----SLFETLARKHTRLDAQLKEPADSAVFVNVSTTP-EDMLQDLSVLEEVLRMVLEILNSCLT 571
                 |||..|::||.::..|..:....:  ::.|..| .|..|||||:|||:||:|||:|||||
  Rat   542 RSYASSLFSLLSKKHNKVLEQATQSLRGS--LSSSDVPLPDYAQDLSVIEEVIRMMLEIINSCLT 604

  Fly   572 NQLVYCPNLVYTLLYKRSVFEGFRSHHAFQDVIQNIDMVVGFFSSRLQRVQEQRGELGVNEVLEV 636
            |.|.:.|||||.|||||.:||.||:|.:|||::||||:|:.||||||   .:...||.|..|||:
  Rat   605 NSLHHNPNLVYALLYKRDLFEQFRTHPSFQDIMQNIDLVISFFSSRL---LQSGAELSVERVLEI 666

  Fly   637 ISKGASQWSSDRLRKFPDLKFKYVEEDAPEEFFIPYVWTLV 677
            |.:|......|||:|||:||||||||:.||||||||||:||
  Rat   667 IKQGVVALPKDRLKKFPELKFKYVEEEQPEEFFIPYVWSLV 707

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8230NP_610431.1 Dymeclin 1..676 CDD:286785 300/754 (40%)
DymXP_017456366.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201363054
eggNOG 1 0.900 E1_KOG2225
Hieranoid 1 1.000
Homologene 1 1.000 H69237
Inparanoid 1 1.050 518 1.000 Inparanoid score I1213
OMA 1 1.010
OrthoDB 1 1.010 D152977at33208
OrthoFinder 1 1.000 FOG0005679
OrthoInspector 1 1.000 T1086748
orthoMCL 1 0.900 OOG5_132417
Panther 1 1.100 LDO PTHR12895
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.