DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and TFPI2

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:104 Identity:34/104 - (32%)
Similarity:53/104 - (50%) Gaps:26/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGVAVVLILLAGIRWSEAFPMDLYDDVSDFFDAISLDDVAN--TGRNTHPEQFCLMPARKGVCRA 71
            :|::::|:.|     :||                :|.|.|.  ||.|.   :.||:|...|.|||
Human     7 LGLSILLLFL-----TEA----------------ALGDAAQEPTGNNA---EICLLPLDYGPCRA 47

  Fly    72 LIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |:.|:.||...:.|.:|.:|||:||.|||.:::.|...|
Human    48 LLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDAC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 23/54 (43%)
TFPI2NP_006519.1 Kunitz_TFPI2_1-like 32..88 CDD:438659 24/58 (41%)
Kunitz_BPTI 95..149 CDD:425421
Kunitz_TFPI1_TFPI2_3-like 155..204 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.