DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and TFPI

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_006278.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens


Alignment Length:57 Identity:26/57 - (45%)
Similarity:36/57 - (63%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCE 111
            |...:||.||.:|:|||...|:.|:....||..||:.||.||||||.|.::|:..|:
Human   212 HGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 25/55 (45%)
TFPINP_006278.1 Kunitz_TFPI1_1-like 51..105 CDD:438656
Kunitz_TFPI1_2-like 121..176 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 214..267 CDD:438658 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.