DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and spint2

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:62 Identity:26/62 - (41%)
Similarity:35/62 - (56%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCEGM 113
            |..:....|..|:..|.|||..||:.||...:.|..|.:|||.||||||.|..:|.::|.|:
Zfish   125 RTLNTTDHCRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASCLGV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 24/54 (44%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633 23/49 (47%)
Kunitz-type 228..276 CDD:438633
Kunitz-type 302..354 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.