DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and CG42827

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:71 Identity:20/71 - (28%)
Similarity:34/71 - (47%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DAISLDDVANTGRNTHPEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYK 104
            |:.||.:.....:....::.||..:..|.|:.....|.|:|::.||..|.:..|.||.|.|.:.:
  Fly    21 DSDSLQEQYEREQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKE 85

  Fly   105 DCMSTC 110
            .|:..|
  Fly    86 SCVEFC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 17/54 (31%)
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 16/49 (33%)

Return to query results.
Submit another query.