DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_063140392.1 Gene:Wfdc6b / 408225 RGDID:1303277 Length:192 Species:Rattus norvegicus


Alignment Length:54 Identity:24/54 - (44%)
Similarity:30/54 - (55%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |..|.:|...|.|.|.:|||.|:.:...|.:|.:|||.||.|||.|...|.|.|
  Rat    84 EDICSLPQDAGPCLAYLPRWWYNKKTNLCTQFIYGGCQGNTNNFLSKDICTSIC 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 24/54 (44%)
Wfdc6bXP_063140392.1 None

Return to query results.
Submit another query.