DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and K11D12.13

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001033498.1 Gene:K11D12.13 / 3896821 WormBaseID:WBGene00044535 Length:188 Species:Caenorhabditis elegans


Alignment Length:61 Identity:24/61 - (39%)
Similarity:32/61 - (52%) Gaps:7/61 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HPEQFCLMPARKGV---C--RALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            ||.: |.:|..||.   |  .|.| |:.:||:...|..||:.||.||.||:.:..||...|
 Worm    18 HPPK-CYLPQAKGTSSNCSYEASI-RYHFDPKTNICHAFKYEGCGGNVNNYETPGDCGQNC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 22/59 (37%)
K11D12.13NP_001033498.1 Kunitz-type 22..76 CDD:438633 21/54 (39%)

Return to query results.
Submit another query.