DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and LOC3292058

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_553610.4 Gene:LOC3292058 / 3292058 VectorBaseID:AGAMI1_012805 Length:155 Species:Anopheles gambiae


Alignment Length:123 Identity:52/123 - (42%)
Similarity:66/123 - (53%) Gaps:37/123 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SEAFPMDLYDDVSD-----FF-------DAISLDD---------------------VANTGRNTH 55
            |.|.|:|:.|.:..     |:       |...|:|                     |...||:  
Mosquito    37 SAAQPIDMLDQIGSESRRMFYKMLEYLGDYDELEDDGGPQEREENGGSLPLQTSNRVEVAGRD-- 99

  Fly    56 PEQFCLMPARKGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTCEGM 113
             || |.:|.|:||||||:||:||||.||:|:||||||||||.|||.|||.||..|:|:
Mosquito   100 -EQ-CKLPPRRGVCRALLPRFRYDPAQKECIEFKFGGCDGNANNFMSYKQCMEACKGV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 39/54 (72%)
LOC3292058XP_553610.4 None

Return to query results.
Submit another query.