DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and AMBP

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:89 Identity:30/89 - (33%)
Similarity:39/89 - (43%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YDDVSDFFDAISLDDVANTGRNTHPEQFCL----------MPARKGVCRALIPRWRYDPEQKKCV 86
            |:..|...:..........|.|...|:.||          :|..:|.|||.|..|.:|..:.|||
Human   249 YNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCV 313

  Fly    87 EFKFGGCDGNENNFASYKDCMSTC 110
            .|.:|||.||.|.|.|.|:|...|
Human   314 LFPYGGCQGNGNKFYSEKECREYC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 26/64 (41%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226
Kunitz_bikunin_1-like 229..282 CDD:438639 7/32 (22%)
Kunitz_bikunin_2-like 284..338 CDD:438640 23/54 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.