DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and Ambp

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001416262.1 Gene:Ambp / 25377 RGDID:2102 Length:361 Species:Rattus norvegicus


Alignment Length:89 Identity:29/89 - (32%)
Similarity:39/89 - (43%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YDDVSDFFDAISLDDVANTGRNTHPEQFCL----------MPARKGVCRALIPRWRYDPEQKKCV 86
            |:..|...:..........|.|...|:.||          :|..:|.|||....|.:|..|.||:
  Rat   248 YNGASMACETFQYGGCLGNGNNFASEKECLQTCRTIAACNLPIVQGPCRAFAELWAFDAAQGKCI 312

  Fly    87 EFKFGGCDGNENNFASYKDCMSTC 110
            :|.:|||.||.|.|.|.|:|...|
  Rat   313 QFIYGGCKGNGNKFYSEKECKEYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 25/64 (39%)
AmbpNP_001416262.1 None

Return to query results.
Submit another query.