DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and T21D12.12

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_499892.1 Gene:T21D12.12 / 188695 WormBaseID:WBGene00020651 Length:183 Species:Caenorhabditis elegans


Alignment Length:72 Identity:22/72 - (30%)
Similarity:31/72 - (43%) Gaps:14/72 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GRNTHPEQFCLMPARKGVCRAL------------IPRWRYDPEQKKCVEFKFGGCDGNENNFASY 103
            |.....:|.|  |.::..|...            .||:.:....|.|:.|.|.|.|||.||||:|
 Worm   113 GYECQNQQCC--PTKENTCSLQYDAGKFGSSGKHTPRYFFSKSYKNCMLFTFYGRDGNANNFATY 175

  Fly   104 KDCMSTC 110
            .:|.:.|
 Worm   176 NECKNFC 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 21/66 (32%)
T21D12.12NP_499892.1 Kunitz_BPTI 23..77 CDD:425421
KU 127..182 CDD:197529 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.