DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and piit-1

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_505943.2 Gene:piit-1 / 185259 WormBaseID:WBGene00009384 Length:200 Species:Caenorhabditis elegans


Alignment Length:96 Identity:28/96 - (29%)
Similarity:36/96 - (37%) Gaps:30/96 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FDAISLDDV-ANTGRNTHP------EQFCLMPARKGVCRALIPRWRYD----------------- 79
            :|...|..| .:.|.||.|      :.|| .|....:|..     .||                 
 Worm   103 YDTDHLTPVRCSAGANTCPQGHNCIQSFC-CPTSNYLCNL-----TYDSGKFAVGGEKSDKYFWV 161

  Fly    80 PEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            |:...|:.|.|.|..||.|||.:|..||:||
 Worm   162 PKYTTCMRFSFYGTLGNANNFPNYNSCMATC 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 21/71 (30%)
piit-1NP_505943.2 Kunitz_BPTI 24..77 CDD:425421
KU 137..192 CDD:197529 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.