DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13748 and C54D10.10

DIOPT Version :10

Sequence 1:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:59 Identity:21/59 - (35%)
Similarity:29/59 - (49%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HPEQFCLMPARKGVCRALIP---RWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110
            :|:..|.:|...|..|....   |:.|.|..|.|:.|.:.|.:||.|||.:|.||...|
 Worm   155 YPDHVCSLPVSSGSERLAFKHYGRYAYQPGLKNCIRFSYFGQEGNFNNFLTYNDCKKFC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 20/57 (35%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:425421
KU 158..213 CDD:197529 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.